KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0185Help
Entry
SSPA0185          CDS       T00756                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSPA0185
Enzymes [BR:sek01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SSPA0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(217664..218143)
Genome map
AA seq 159 aa AA seqDB search
MTIAYIALGSNLASPLEQVNAALKAIADIPDSRIVAVSSFYRTPPLGPQDQPDYLNAAVA
LDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDEVINTDRLTVPHYDMK
NRGFMLWPLFEIAPELIFPDGTSLHQHLTHLGAAKPAHW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgcgtatatcgcgcttggcagtaatctggcctctccgctggagcaggtcaat
gccgccctgaaggctatcgccgacattcccgatagccgtatcgtcgcggtttcttcgttt
taccgcacgccgccgcttggcccacaggatcagcccgattacctgaacgctgcggtggcg
ctggataccgctctcgcccccgaagaattgcttaaccatacccagcgcattgagctgcaa
cagggccgggtgcgcaaggccgaacgctgggggccgcgcacgctggatctcgacattatg
ctgtttggcgatgaagtcattaacaccgaccgtctgaccgtgccgcactacgacatgaaa
aaccgcggttttatgctgtggccgttattcgaaatcgctccggagctgatctttccggat
ggtaccagcctgcatcagcatctcacccatcttggtgctgcaaaacccgcccactggtaa

DBGET integrated database retrieval system