KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0608Help
Entry
SSPA0608          CDS       T00756                                 

Definition
PTS system fructose-specific transporter subunit IIBC
Orthology
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Fructose and mannose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sek00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:sek02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
725948..727636
Genome map
AA seq 562 aa AA seqDB search
MKTLLIIDANLGQARAYMAKTLLGAAAHKANLEIIDNPNDAELAIVLGESLPNDNALNGK
KVWLGDIGRAVAHPELFLSEAKSHATPYSAPAAAAPAASGGPKRVVAVTACPTGVAHTFM
AAEAIETEAKKRGWWVKVETRGSVGAGNAITPEEVAEADLVIVAADIEVDLAKFAGLPMY
RTSTGLALKKTAQELDKAVAEATPYQPAGKASQAATEGKKESAGAYRHLLTGVSYMLPMV
VAGGLCIALSFAFGIEAFKVPDTLAAALMQIGGGSAFALMVPVLAGYIAFSIADRPGLTP
GLIGGMLAVSTGSGFIGGIIAGFLAGYMAKLISTKLKLPQSMEALKPILIIPLISSLVVG
LAMIYLIGKPVAGILEGLTHWLQTMGTANAVLLGAILGGMMCTDMGGPVNKAAYAFGVGL
LSTQTYAPMAAIMAAGMVPPLALGLATMVARRKFDKAQQEGGKAALVLGLCFITEGAIPF
AARDPMRVLPCCIVGGALTGAISMAVGAKLMAPHGGLFVLLIPGAITPVLGYLLAIVAGT
LVAGLAYAVLKRPETEVAAKAA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgctgctgataattgacgctaatctcggccaggctcgcgcttacatggcgaaa
accctgcttggagcggcggcgcataaagcaaatctggaaattatcgataatccaaatgat
gctgagctggcgatcgtgttgggcgaatctctgccgaacgacaatgctctgaacggcaaa
aaggtttggctgggggatattggtcgcgccgtcgcgcatccggaactgtttctgagtgaa
gccaaaagccatgcgaccccttacagcgcccctgctgcggctgctcctgcggcgagcggc
ggtccgaaacgcgtggtcgcggtaacggcctgcccgaccggcgtcgcccatacttttatg
gcggctgaagccattgaaacagaagcgaaaaaacgcggctggtgggtaaaagtcgaaacg
cgcggctccgtgggggccggcaatgccatcaccccggaagaggtggcggaagcggattta
gtgattgtggcggcggatatcgaagtggatctggcgaagtttgccggtctcccgatgtac
cgcacgtcgaccggcctggcgctgaaaaagacggcgcaggagctggataaagccgtagcg
gaagcaacgccgtatcaaccggcgggtaaggcatcgcaagcggcgaccgaagggaagaaa
gagagcgctggcgcataccggcatctattgacgggcgtttcttacatgctgcctatggtg
gttgccgggggactgtgtattgcactttccttcgcctttggtattgaagcctttaaggtg
ccggacacgctggcggcggcgctgatgcagattggcggcggttcggcgtttgcgctgatg
gtgccggtactggcgggttatatcgctttctccatcgcggatcgcccaggccttacgccg
ggtctgattggcggtatgctggcggttagcaccggttccggttttatcggcgggatcatt
gccggcttccttgccgggtatatggcgaagcttatcagtaccaaactgaaacttccgcaa
agtatggaagcgctgaagccaatcctgatcatcccgttaatttccagtctggtggtgggg
ctggcgatgatttacctgatcggtaaaccggttgccgggattctggaagggctcacccac
tggctgcaaaccatgggaaccgcaaacgcagtgctgttgggcgcgattctcggcgggatg
atgtgtaccgacatgggcggcccggtgaacaaagcggcgtatgcgtttggcgttggtctg
ctgagtacgcaaacttacgcgccgatggcggcgatcatggccgcaggtatggtaccgccg
ttagcgctgggtctggcgacgatggtggcgcgccgtaagttcgacaaagcgcagcaggaa
ggcggtaaagcggcgttggtgctggggctgtgctttatcactgaaggcgctattccgttt
gcggcgcgcgacccgatgcgtgtactgccgtgctgtatcgttggcggcgcgttgaccggg
gccatttctatggcggtaggcgcaaaattgatggcgccgcatggcggtctgtttgttctg
cttatcccaggcgcaattacgccggtattgggatacctgctggcaattgtggccggtacg
ctggtggcagggctggcttatgccgtcctgaaacgtccggagacggaagtcgcggcaaaa
gcggcgtaa

DBGET integrated database retrieval system