KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA0618Help
Entry
SSPA0618          CDS       T00756                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSPA0618 (folE)
Enzymes [BR:sek01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SSPA0618 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
740095..740763
Genome map
AA seq 222 aa AA seqDB search
MPSLSKEAALVHDALVARGLETPLRPPMDELDNETRKSLIAGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILTALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcagtaaagaagcggccctggttcatgacgcgctggttgcccgggggctg
gaaacgccgctgcgcccgcctatggatgaactggataatgaaacgcgaaaaagccttatc
gcagggcatatgactgagattatgcagttgctgaatctcgatttgagcgatgacagtctg
atggaaacgccgcatcgtatcgctaagatgtacgttgacgagattttcgctggcctcgac
tatgccaatttcccgaaaattaccctcattgaaaataaaatgaaggtggatgaaatggtc
accgtccgcgatatcacgctgaccagcacctgtgaacatcacttcgtgaccattgatggc
aaagcgaccgtcgcgtatatccccaaagattccgtgatcggcctgtcaaaaattaaccgc
atcgtgcaattcttcgcccagcgtccgcaggttcaggaacgtttgacccaacaaattctg
acggcgctgcaaaccttgctcggcaccaataatgtagcggtatcgattgatgcggtgcat
tactgcgtgaaagcgcgcggtattcgtgacgcaaccagcgccacgacgacgacgtcgctg
ggcggattgtttaagtccagccagaatacgcgccaggagtttctgcgtgccgttcgccat
catccatga

  All links  
No link information was found.   
DBGET integrated database retrieval system