KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA1069Help
Entry
SSPA1069          CDS       T00756                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek00260  Glycine, serine and threonine metabolism
sek00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sek01100  Metabolic pathways
sek01110  Biosynthesis of secondary metabolites
sek01130  Biosynthesis of antibiotics
sek01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSPA1069
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSPA1069
Enzymes [BR:sek01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SSPA1069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NMO NanE
Motif
Other DBs
NCBI-ProteinID: CAR59223
UniProt: B5BIC0
Structure
PDB: 

Jmol
Position
complement(1211106..1211912)
Genome map
AA seq 268 aa AA seqDB search
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGANALELGVPFSDPLAD
GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQ
VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRS
GVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKI
IEKNLASPEQMLAELRSFVSAMKAASRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaaaatttatttgcccaactcaacgatcgccgggaaggcgcttttgtc
cccttcgtgaccctgggcgaccctggcattgagcagtcactgaaaattatcgacacactg
attgacgctggcgccaacgctctggaactgggggttcccttctccgatccgctggccgat
ggccccaccatccagaatgcgaacttacgcgccttcgccgctggcgtcacgccggctcag
tgttttgaaatgctggcgctgattcgtgaaaaacacccaaccattccgattggcctgcta
atgtacgcgaatctggtgttcaataacggcatagatgcgttctatgcccgctgtgaacag
gttggcgtagattccgtgctggtcgcagatgtcccggttgaagaatcggcccccttccgc
caggcggcgttacggcataatatcgcgccgatcttcatctgcccgccaaatgcggatgac
gatcttctgcgccaggtcgcatcttacggccgcggttacacctacctgctttcgcgttcg
ggcgtcaccggcgcggaaaaccgtggcgcattgccgttgcatcatctcattgagaagctt
aaagagtaccatgccgcgcctgcgttacagggcttcggtatctcctcgccggaacaggtg
tctgcggccgtgcgtgccggggcggctggcgctatctccggctcagccattgtcaagatt
atcgagaaaaacctcgcgtctcccgaacagatgttggcggagctcaggtcctttgtctca
gccatgaaagccgccagccgcgcataa

DBGET integrated database retrieval system