KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA1394Help
Entry
SSPA1394          CDS       T00756                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sek00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sek00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1572827..1573378)
Genome map
AA seq 183 aa AA seqDB search
MQNSLLNTHVTTIDGEVTTLEKYAGKVLLIVNVASRCGLTPQYEQLENIQKAWADQGFVV
LGFPCNQFMGQEPGSEEEIKTYCASTWGVTFPMFSKIDVNGDARHPLYQKLIAAAPTAVA
PEKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQRFSPDMTPEDPIVMESIKIA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaactcgcttcttaatactcacgttacgacgattgatggagaggtcactacactt
gaaaaatacgccggaaaagtgctgctcattgtaaacgtcgcctccagatgtggcctgacg
ccgcaatatgaacagttggaaaatatccagaaggcgtgggcagatcaggggtttgtcgtg
ttgggttttccctgcaaccagtttatggggcaggagccaggcagcgaagaggagattaaa
acctattgtgccagcacctggggcgtcacgttcccgatgttcagtaaaattgatgtgaat
ggcgacgcgcgccatccgctgtatcaaaaactgatagccgctgcgccaacggcagtcgcg
ccggagaagagcggcttttacgaacggatggtaagcaaagggcgtacgccactctatccg
gatgatattctgtggaattttgaaaaatttttggtaggccgggatggtcaggtagtacag
cgtttttcgccggatatgacgcctgaagatcctattgtgatggaaagcataaaaatcgcg
ttggcaaaataa

DBGET integrated database retrieval system