KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA1446Help
Entry
SSPA1446          CDS       T00756                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSPA1446
Enzymes [BR:sek01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SSPA1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
1625656..1626540
Genome map
AA seq 294 aa AA seqDB search
MINKIFALPVIEQLTPVLSRRQLDDLDLIVVDHPQVKASFALQGAHLLSWKPVGEEEVLW
LSNNTPFKTGVALRGGVPICWPWFGPAAQQGLPSHGFARNLPWALKAHNEDDNGVMLTFE
LQSSEATRKYWPHDFTLLARFKVGKTCEIELEAHGEFATTSALHSYFNVGDIANVKVSGL
GDRFIDKVNDAKEGVLTDGIQTFPDRTDRVYLNPEACSVIHDATLNRTIDVVHHHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETVYATAPQQATEEKPSRLAQTICVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaaatttttgccctcccggttatcgaacagcttacccctgtcctttcccgt
cgtcagcttgatgacctggatctgatcgtcgttgaccatccgcaggttaaagcctctttt
gcattacagggcgcgcaccttctctcctggaaacccgttggcgaggaagaggtattgtgg
ctcagtaataatacgcctttcaaaaccggcgtggcgctacgcggcggtgtaccgatctgc
tggccctggtttggacctgcggctcaacagggtctgccgtcacacggctttgcgcgtaat
ctaccgtgggcgctaaaagcgcataatgaagatgataatggcgtaatgctgacatttgag
ctgcaaagcagtgaggccacccggaaatactggccgcacgatttcacgctgctggcacgt
tttaaagtgggcaaaacctgtgaaattgaactggaagcgcatggcgagtttgcaaccaca
tccgcgctccacagctattttaacgttggcgacatcgccaacgttaaggtcagcggactc
ggcgatcggtttattgataaagttaacgacgctaaagaaggtgtcctgaccgacggtata
caaacctttccggaccgtaccgatcgcgtttacctcaatcctgaagcatgtagcgtgatc
cacgatgcgacattaaaccgcacgattgatgtggtccaccaccatcaccttaacgtcgta
ggctggaaccctggcccggcgttgtccgttagcatgggcgacatgccggatgacggctat
aaaacgtttgtctgcgttgaaacggtttacgctactgcgccgcaacaagccacagaagaa
aaaccctctcgtctggcgcagactatctgcgtcgctaaacgctaa

DBGET integrated database retrieval system