KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA1569Help
Entry
SSPA1569          CDS       T00756                                 

Definition
dihydroorotase
Orthology
K01465  
dihydroorotase [EC:3.5.2.3]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SSPA1569
Enzymes [BR:sek01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     SSPA1569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1744497..1745543
Genome map
AA seq 348 aa AA seqDB search
MTAPSQVLKIRRPDDWHVHLRDGDMLKTVVPYTSEIYGRAIVMPNLASPITTVDAAIAYR
QRILDAVPAGHDFTPLMTCYLTDSLDADELERGFHEGVFTAAKLYPANATTNSSHGVTSV
DAIMPVLERMEKLGMPLLVHGEVTHADVDIFDREARFIDTVMEPLRQRLTALKVVFEHIT
TKDAAQYVRDGSDNLAATITPQHLMFNRNDMLVGGIRPHLYCLPILKRNIHQQALRDLVA
SGFTRAFLGTDSAPHSRHRKETRCGCAGCFNAPSALGSYAAVFEEMNALAHFEAFCSLNG
PQFYGLPVNTGWVELVRDEQQIPENIALADDSLVPFLAGETVRWSVKK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaccatcccaggttttaaagatccgccgcccggacgactggcacgttcacctt
cgcgatggcgacatgttaaaaacggtcgtaccctataccagcgaaatttatggtcgcgct
atcgtgatgccgaacctggcgtcccccatcacgaccgttgatgcagcgatcgcctaccgc
cagcgtattctcgatgcggtgcccgccgggcatgatttcacgccgttaatgacctgctat
ttaacggattcgctcgatgccgatgaactggagcgtggtttccatgaaggcgtgtttact
gcggccaagctttacccggccaatgccaccactaactccagtcatggcgtaacgtcagtc
gacgctatcatgccggtactggagcggatggaaaaactcggaatgccattgctggtccac
ggtgaggtgacccatgcggatgttgatatcttcgatcgcgaagcgcgttttatcgacacc
gtaatggaaccgctacgccagcgtctgaccgcgcttaaagtggtctttgaacacatcaca
accaaagatgccgcgcagtatgtacgtgacggcagcgacaacctggcggcgaccattacg
cctcaacatttaatgtttaaccgtaatgatatgctggtcggcggcattcgtcctcacctg
tactgtctgccgattctgaaacgcaatattcaccagcaggcgttacgcgacctggtcgcc
agtggttttacgcgcgccttcctggggacggattcagcgccgcattcacgtcatcgtaaa
gagacccgttgcggctgcgccggttgtttcaacgccccctccgctcttggcagttatgcc
gccgtgtttgaggaaatgaacgcgctggcgcactttgaagcgttctgttcactgaatggc
ccgcaattctatggcctgccggtgaatacggggtgggtggaactggttcgcgatgaacaa
cagataccggaaaatatcgcgctggctgatgattcgctggtgccttttttagcgggtgaa
acagtacgctggtcagtaaaaaaataa

DBGET integrated database retrieval system