KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA1570Help
Entry
SSPA1570          CDS       T00756                                 

Definition
DNA damage-inducible protein I
Orthology
K12149  
DNA-damage-inducible protein I
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1745617..1745862
Genome map
AA seq 81 aa AA seqDB search
MRIEVTIAKTSPLPAGAIDALAGELSRRISHHFPENLGNVTVRYATANNLSVIGASKEDK
ERISEILQETWESADDWFINE
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattgaagtcactatagccaaaacgtcacctctgcctgccggtgcgattgatgcg
ctggcgggcgaactctcccgtcgtattagccatcattttcctgagaacttggggaacgtc
accgtgcgttacgctaccgccaacaacttgtccgtcattggcgcatcaaaagaggacaaa
gaacgcattagcgagattctccaggagacctgggagagcgctgatgactggttcatcaat
gaataa

DBGET integrated database retrieval system