KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA1833Help
Entry
SSPA1833          CDS       T00756                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sek00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sek00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2043651..2044934
Genome map
AA seq 427 aa AA seqDB search
MNTLSVSRLALALAFGVTLSACSSTPPDQIPSDQTAPGTASRPILSANEAKNFVAARYFA
SLTPNTAPWSPSPITLPAQPDFVVGPAGTPGVTHTSIQAAVDAAMVKRTNKRQYIAIMPG
DYQGTVYVPAAPGSLTLYGTGEKPIDVKIGMAIDGEMSVADWRRAVNPGGKYMPGKPAWY
MFDNCQSKHAATIGVMCSAAFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDKV
QINKVNILGRQNTFFVTNSGVQNRLQTDRQPRTLVTNSYIEGDVDMVSGRGAVVFDNTNF
QVVNSRTQQEAYVFAPATLSNIYYGFLAINSRFNASGDGVAQLGRSLDVDANTNGQVVIR
DSVINEGFNVAKPWADAVISKRPFAGNTGTVDDKDEVQRNLNDTNYNRMWEYNNRGVGSK
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacattatcggtttcccgtctggcgctggcactggcttttggcgtgacgctgagc
gcctgtagctctacgccacccgatcagatcccttccgatcaaaccgcgcctggcaccgcc
tcgcgcccaattctgtcggcaaatgaagcgaaaaacttcgttgcggcgcgctattttgcc
tccctgacaccgaataccgccccgtggtcgccgtcgccgattaccctgcccgcacagcct
gactttgtggtggggccggcaggtacgccaggcgttacgcacacctcaattcaggccgcg
gtcgatgcggcaatggttaaacgcacgaacaaacgtcagtacattgctattatgccgggc
gactatcaggggaccgtgtatgttcccgccgcgccgggaagtctgaccctgtacgggacc
ggtgaaaaaccgatcgatgtgaaaattgggatggcgattgatggtgaaatgagtgtcgct
gactggcgccgcgcggtgaatcccggcgggaaatatatgcctggtaaacccgcctggtat
atgttcgataactgccaaagcaaacacgccgcgacgatcggtgtgatgtgttctgccgcg
ttctggtcgcagaataacggtctgcagctacaaaatctgaccatcgagaacacgctgggc
gacagcgtcgatgccggaaaccatccggcggtggcgctgcgtaccgatggcgacaaagtc
cagattaacaaggtcaatatccttggccgccagaacaccttctttgtgaccaacagcggc
gtgcagaaccgtctgcaaaccgatcgtcagccgcgtacgctggtgacgaacagctatatt
gaaggcgatgtggatatggtttccggacgcggcgccgtggtgttcgataacaccaacttc
caggtcgtcaactcccgcacacagcaggaagcctacgtcttcgccccggcgacgctgtcc
aatatttactatggctttttggcgatcaacagccgctttaacgcctccggcgatggcgtt
gcgcagcttggccgctcgctggatgtcgacgctaacaccaacggtcaggtcgtgatccgc
gacagcgtgattaacgagggcttcaacgttgccaaaccatgggccgacgcggtcatctcg
aaacgtccgtttgccggaaatacgggaaccgtggatgacaaagacgaggtgcagcgtaat
ctgaacgacactaactacaaccgcatgtgggaatacaacaaccgcggtgtaggcagtaaa
gtggtggcggaacctaagcagtaa

DBGET integrated database retrieval system