KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA1868Help
Entry
SSPA1868          CDS       T00756                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSPA1868
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SSPA1868
  Amino acid metabolism
   00310 Lysine degradation
    SSPA1868
Enzymes [BR:sek01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SSPA1868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2079958..2081166)
Genome map
AA seq 402 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEEEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLEASAIKGTGVGGRLTREDVEKHLAKGESKAPAVEPAAQPALGARGEKRVPMTR
LRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEVFEKRHGIRLGFMSFYVKAVV
EALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELA
VKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVDGKVE
ILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgagtccgtagcggacgcgaccgtc
gccacctggcataaaaaaccgggtgatgcggttgttcgtgacgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcggacggcattctggatgcggtt
ctggaagaggaggggacgactgtcacctctcgccagatcctgggtcgcctgcgtgaaggc
aacagcgcgggtaaagagaccagcgccaaatctgaagagaaagcgtctacgccggcacag
cgccagcaggcgtcgctggaagaacaaaacaacgatgcgctcagcccggcgatccgtcgc
ctgctggctgaacacaatctggaagccagcgccattaaaggcactggtgtgggtgggcgt
ctgacccgtgaagatgtggaaaaacatctggcgaaaggcgagtctaaagcacccgctgtt
gaacctgcagcacaacccgctctgggcgcgcgcggcgaaaaacgcgtgccaatgacccgc
ctgcgtaagcgcgtggccgagcgtctgctggaagcgaaaaattccaccgccatgctgacg
accttcaatgaagtcaacatgaagccgattatggatttgcgtaagcagtatggcgaagtg
tttgaaaaacgtcatggtatccgcctgggctttatgtccttctacgtgaaagcggtagta
gaagcgctgaagcgttatccggaagtgaacgcctctatcgacggcgatgacgtggtgtac
cacaactactttgatgtgagcatggcggtgtctacgccgcgcggcctggtcacgccggtc
ctgcgtgacgtggatacgctgggcatggctgacattgagaaaaaaattaaagaactggct
gtcaaaggccgcgacggcaagctgaccgtagaagacctgaccggcggtaactttaccatt
accaacggcggcgtattcggttcgctgatgtctaccccgatcatcaacccgccgcagagc
gcgattctgggaatgcatgctattaaagacaggccgatggcggtggatggcaaggtggaa
atcctgccgatgatgtacctggcgctctcttacgatcatcgcctgatcgatggtcgcgaa
tccgtgggcttcctggtcaccatcaaagagttgctggaagatccgacccgtctgctgttg
gacgtgtag

DBGET integrated database retrieval system