KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA2206Help
Entry
SSPA2206          CDS       T00756                                 

Definition
DNA restriction helicase
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Brite
Enzymes [BR:sek01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     SSPA2206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2460317..2463286)
Genome map
AA seq 989 aa AA seqDB search
MNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKERYDDKANIDVKMETGTGK
TYVYTRLMYELHQKYGLFKFVLVVPTPAIKEGARNFITSDYARQHFSQFYENTRMELCTI
NAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQMLNSASMTRDDYDQTLLGGL
TSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMIVRFGATFPDIVEGKGKNKCV
RKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPEEQANNRYIVDSVTAKKLILRRGSK
IAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLELEAGMALVPGTFGASYQELIIQDAID
KHFDTEQANFLRSNEPENNAPRIKTLSLFFIDSIKSYRDDEGWLKLKFECLLKKKLTQLI
DDYQRKTLPREVEYLSFLQATLASLHSDNQNVHAGYFGEDRGSGDEAIQAEVDDILKNKE
KLLSFSDHHGNWETRRFLFSKWTLREGWDNPNVFVIAKLRSSGSESSKIQEVGRGLRLPV
DENGHRVHQEEWPSRLSFLIGYDEKAFASMLVDEINRDSKVQLNEQKLDEAMITLIVTER
QKVDPAFTELRLLEDLDDKKLINRSNEFKPSVTLNGETKSGFAWLLKFYPELTQARVRAD
RIRDNKPASRLRVRLRKENWEQLSSIWEQFSRRYMLQFERSGASLEQIAAEVLRDPALYI
RQKPSQVQQRLVSNEDNGRFEVAQREGELAASEFMAGMKYGHFLKQLALRTSLPVNVLHP
VLMAMLRDVLHGDSRYLSEISLDNMTRALQTRINAHFAQRHDYLPLDFQASTSVFDSTAR
QFREEISAEIVGKNVDENAIDDPRSLYQIPPLRYDSVDPELPLLKYDYPQQVSVFGKLPK
RAIQIPKYTGGSTTPDFVYRIERQDADSVYLLVETKAENMRVGDQVILDAQRKFFDMLRR
QNINVEFAEATSAPAVFSTINGLIEGKVN
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttactggaagaacttccccatcaggaacaggcgttagcggcgattctggcg
agtttcaccggtatcgatcacgcgcaggccgatcataatcactatgctaatccgctgatt
aaggaacgttacgacgataaggccaatattgacgttaaaatggagaccgggacgggcaaa
acctatgtctatacccggttgatgtatgaactgcatcagaagtatggcctcttcaaattt
gtgctggtggtgccgacgccagccattaaagaaggcgcgcggaactttatcaccagcgat
tacgccagacagcatttttcacagttctacgaaaatacgcggatggaactttgcaccatc
aacgccggtgattttaaagtaaagtcggggcgtaaaaattttccggcccagttattaagt
tttactgatgccagccgtcgtgatagccatacgattcaggttttgctgatcaatgcgcaa
atgctcaattccgccagtatgacgcgagacgattacgatcaaacgctactgggcgggctg
acgtcgcctgttaaagggctgcaaatgacgcgaccggtggtcattattgatgaaccgcat
cgttttgcgcgagataacaaattttatcgagcgattcaggccattcagccgcaaatgatc
gtccgctttggcgctaccttcccggatattgtcgaaggtaagggtaaaaataaatgtgta
cgtaaagattactatcgccggcaaccgcagtttgatctcaacgcggtggacagttttaac
gatggtttggtgaaaggtattgatatttattacccgaatctccccgaagaacaggccaac
aatcgttatatcgttgacagcgtcacggcaaagaaattaatcctccgacgggggagcaaa
attgccgaggttggcgtgggcgaaaatctcgccgatgtcgatgcaggatttgaaggcagt
atcgaatatgccggcagtaaaatgttgtcgaacgatctggagctggaggcagggatggcg
ctggtgccaggaacctttggcgcgagctaccaggaactgattattcaggacgccattgat
aagcattttgataccgagcaggcaaatttcttacgcagcaatgagccagaaaataatgcc
ccgcgtattaagaccttaagccttttctttattgacagtattaaaagctatcgtgatgac
gaaggttggttgaaactgaagtttgagtgtttactgaaaaagaaactgacgcaactgatt
gacgattatcagcgcaagaccctgccgcgagaagtggagtatctgtcgtttctgcaggcc
acgctcgccagcctgcactcggataaccaaaacgtccacgctggttactttggcgaagac
cgcggaagcggcgatgaggcgatccaggctgaggtagatgatattctgaaaaataaagag
aagttgctcagtttttcagaccatcacggcaactgggaaacgcgccgctttctgttttca
aaatggacgcttcgcgaaggctgggataacccgaatgtttttgtcattgctaaattacgt
tcttccggtagcgagtcgagcaaaattcaagaagtggggcgcggcctgcggctaccggta
gatgaaaacggccatcgcgttcatcaggaagagtggccgtcccgactgtcgtttctgatt
ggttatgatgaaaaagcgtttgccagtatgctggttgatgagattaatcgcgacagcaaa
gttcagcttaacgagcagaaactggatgaggcgatgatcacactcatcgtcaccgagcgg
caaaaagtcgatcctgcgtttacggagcttcgtttgctggaagatctggatgataaaaaa
ctgatcaaccggagtaatgagtttaaacccagcgtcacgcttaacggggaaaccaaaagt
ggttttgcgtggctactgaagttctaccctgagctgacgcaggcgcgggtgcgagcggat
cgcattcgtgacaataagcccgcctcccgactgcgagtcaggttacgcaaagagaattgg
gaacaacttagcagtatctgggagcagttttcccgccgttatatgctgcaattcgagcgt
agcggcgcgtctctggaacagattgccgccgaggtgctgcgcgatccggcgctgtatata
cgccagaagccaagccaggttcaacaacggctggtatcgaatgaagataatggccgtttt
gaagtggcgcagcgggaaggcgaattagccgccagcgaatttatggcgggcatgaaatat
ggccattttcttaagcaactggcgttacgcaccagtctgccggttaacgtcctgcacccg
gtgttaatggcgatgctgcgtgatgttttgcacggagattcacgctatttaagcgagatc
tcgttggacaatatgacccgcgcattacagacgcggattaatgcgcattttgcgcagcgc
cacgattatctgcctctcgattttcaggcttcaacgtcggtatttgattccacggcacgg
cagttcagagaggagattagcgctgaaattgtggggaaaaatgtggatgagaatgcgata
gacgatcctcgttctctctatcaaataccgccgttgcgttatgacagcgtcgatccagaa
ttgccgctattaaaatacgattatccgcaacaggtttctgtgtttggcaaactgcctaag
cgggccattcagatccccaaatatacggggggctctactacgccggattttgtgtaccgt
attgagcgtcaggacgccgacagcgtttatttactggttgaaactaaagcagaaaatatg
cgcgtaggcgatcaggttattcttgatgcgcaacgtaaattcttcgatatgctgcgtcgg
caaaatatcaatgtcgagtttgcggaagcgaccagcgcgccggcggtattttctaccatc
aatggcttgattgaggggaaagtaaactaa

DBGET integrated database retrieval system