KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA2271Help
Entry
SSPA2271          CDS       T00756                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSPA2271
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SSPA2271
Enzymes [BR:sek01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SSPA2271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2524586..2525689)
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADMEDRERFLNARDT
LRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
SNPQAELIKDVYGVDDALRSVAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIASGSKPG
VIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEITVDEGATAAMLERGSSLLPKGI
KSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDALRRIAGHHSQQIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtcgtaaaactcggcaccagcgtgctaacaggcggatcg
cgccgcctgaaccgtgcccatatcgtagaacttgtccgccagtgcgcgcagctacacgcc
gcgggacatcgtattgttatcgttacctctggcgcgattgccgccggacgtgaacatctc
ggctacccggaactgccggcaacaattgcctctaaacagcttctggcggcggtagggcaa
agccgcctgattcaactgtgggagcagttgttttcaatttacggtatccatatcgggcag
atgctgttgacgcgtgcggatatggaagacagagagcgctttctgaacgcccgcgatacg
ctgcgtgcgttactggacaaccatattgtgccggtgatcaatgaaaatgatgccgttgcg
acagcggaaattaaagtgggcgataacgataacctctccgcgctggcggcgatcctggca
ggcgcggataaactgctgctgctgaccgatcaacaaggattatttaccgccgatccgcgt
agcaatccgcaggcggagcttatcaaagatgtgtatggcgttgacgatgcgctgcgctct
gtcgcgggagacagcgtttccgggctgggcaccggtggtatgagcactaagcttcaggcg
gcagacgtggcctgccgcgcgggtattgatacgattattgcctcaggcagtaaaccgggc
gtgatcggcgatgtgatggaggggatttccgtcggcacccgttttcatgcgcaagcctcg
ccgctggagaaccgcaaacgctggatcttcggcgcgccgccggcaggcgaaattacggtt
gatgaaggcgcgaccgcggcaatgctggaacgtggcagttcacttctgccaaaaggcatc
aaaagcgtgacgggcaatttctcgcggggggaggtcatcagaatttgtaacctgcaaggg
cgtgatattgctcatggcgtcagccgttataacagtgatgctctgcggcggatagccggt
caccactctcaacaaatcgatgcgattctgggctatgaatatggcccggtcgctgttcat
cgtgatgacatgattactcgataa

  All links  
No link information was found.   
DBGET integrated database retrieval system