KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA2660Help
Entry
SSPA2660          CDS       T00756                                 

Definition
(GenBank) N-acetylglutamate synthase
  KO
K14682  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
sek00220  Arginine biosynthesis
sek01100  Metabolic pathways
sek01110  Biosynthesis of secondary metabolites
sek01130  Biosynthesis of antibiotics
sek01210  2-Oxocarboxylic acid metabolism
sek01230  Biosynthesis of amino acids
Module
sek_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SSPA2660
Enzymes [BR:sek01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     SSPA2660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_6 Acetyltransf_9
Motif
Other DBs
NCBI-ProteinID: CAR60902
Position
2956134..2957465
Genome map
AA seq 443 aa AA seqDB search
MIKERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHDNFSSIVSDIGLLHSLGIRLV
VVYGARPQIDANLAAHHHEPIYHKNTRVTDAKALELVKQAAGLLQLDITARLSMSLNNTP
LQGAHINVVSGNFTIAQPLGVDDGVDYCHSGRIRRIDEDAINRQLDNGAIVLMGPVAVSV
TGESFNLTSEEIATQLAVKLKAEKMIGFCSSQGVTNSEGGIISELFPNEAQARVEELEAQ
GDYNSGTVRFLRGAVKACRSGVRRCHLISYQEDGSLLQELFSRDGIGTQIVMESAEQIRR
ATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNMTIACAALYPFVEEKI
GEMACVAVHPDYRSSSRGEVLLERVAAQARQMGLRKLFVLTTRSIHWFQERGFTPVDIEL
LPESKKKMYNYQRRSKVLMADLG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgataaaggaacgtaaaaccgaactggtagaagggtttcgccattcagttccctatatc
aacacccatcgcggaaaaacctttgtcattatgctcggcggcgaagccattgagcatgac
aatttttccagcatcgttagcgatatcgggctactgcatagcctcggtattcgccttgtc
gtggtgtatggcgcgcgaccgcaaatcgacgccaatctggccgcgcatcatcatgaaccg
atttaccacaaaaacacgcgggtgacggacgccaaagcactggagctggtgaaacaggcc
gccggtttactccagcttgatattaccgcccgtctgtcgatgagtctgaacaatacgccg
ttgcagggcgcgcacattaatgtcgtcagcggcaatttcaccattgcgcagccgctgggc
gttgatgatggcgtggactactgtcatagcggccgtatccggcgcattgatgaagatgcg
atcaaccgccagttggataacggcgcgatcgttctgatggggccggtcgccgtctcagtg
accggtgaaagttttaatctgacctcagaagagattgccactcaactcgccgttaaactg
aaagcggaaaaaatgatcggtttctgttcttctcagggcgttaccaatagcgagggcggc
atcatttctgaactcttcccgaatgaagcacaggcgcgggtggaagagttggaagcgcag
ggcgattacaactccggaaccgtacgttttttgcgcggcgcggtaaaagcctgtcgtagc
ggcgttcgtcgttgccatctgatcagctatcaggaagatggctcgctattacaggaactg
ttctcgcgtgatggtatcggtacgcagatcgtcatggagagcgccgagcagatccgccgc
gctaccatcaacgatattggcggtattctggagcttatccgcccactggaacagcagggc
attctggtacgccgttcccgtgaacaactggagatggagatcgataaatttaccattatt
cagcgcgataatatgactatcgcctgcgcggcgctgtatccttttgtggaagagaaaata
ggcgaaatggcctgcgtagcggtacatccggattaccgcagctcatcgcgtggagaagtg
cttctggagcgggttgccgcccaggcgcggcaaatggggctgcgtaaattgtttgtgctg
acgacgcgcagtattcactggttccaggagcgcggtttcacgcctgtcgatattgagtta
ctgcctgagagcaagaaaaaaatgtataactatcagcgacgttcaaaggtgctgatggcg
gatttagggtaa

DBGET integrated database retrieval system