KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA2660Help
Entry
SSPA2660          CDS       T00756                                 

Definition
N-acetylglutamate synthase
Orthology
K14682  
amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SSPA2660
   01230 Biosynthesis of amino acids
    SSPA2660
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SSPA2660
Enzymes [BR:sek01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     SSPA2660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2956134..2957465
Genome map
AA seq 443 aa AA seqDB search
MIKERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHDNFSSIVSDIGLLHSLGIRLV
VVYGARPQIDANLAAHHHEPIYHKNTRVTDAKALELVKQAAGLLQLDITARLSMSLNNTP
LQGAHINVVSGNFTIAQPLGVDDGVDYCHSGRIRRIDEDAINRQLDNGAIVLMGPVAVSV
TGESFNLTSEEIATQLAVKLKAEKMIGFCSSQGVTNSEGGIISELFPNEAQARVEELEAQ
GDYNSGTVRFLRGAVKACRSGVRRCHLISYQEDGSLLQELFSRDGIGTQIVMESAEQIRR
ATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNMTIACAALYPFVEEKI
GEMACVAVHPDYRSSSRGEVLLERVAAQARQMGLRKLFVLTTRSIHWFQERGFTPVDIEL
LPESKKKMYNYQRRSKVLMADLG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgataaaggaacgtaaaaccgaactggtagaagggtttcgccattcagttccctatatc
aacacccatcgcggaaaaacctttgtcattatgctcggcggcgaagccattgagcatgac
aatttttccagcatcgttagcgatatcgggctactgcatagcctcggtattcgccttgtc
gtggtgtatggcgcgcgaccgcaaatcgacgccaatctggccgcgcatcatcatgaaccg
atttaccacaaaaacacgcgggtgacggacgccaaagcactggagctggtgaaacaggcc
gccggtttactccagcttgatattaccgcccgtctgtcgatgagtctgaacaatacgccg
ttgcagggcgcgcacattaatgtcgtcagcggcaatttcaccattgcgcagccgctgggc
gttgatgatggcgtggactactgtcatagcggccgtatccggcgcattgatgaagatgcg
atcaaccgccagttggataacggcgcgatcgttctgatggggccggtcgccgtctcagtg
accggtgaaagttttaatctgacctcagaagagattgccactcaactcgccgttaaactg
aaagcggaaaaaatgatcggtttctgttcttctcagggcgttaccaatagcgagggcggc
atcatttctgaactcttcccgaatgaagcacaggcgcgggtggaagagttggaagcgcag
ggcgattacaactccggaaccgtacgttttttgcgcggcgcggtaaaagcctgtcgtagc
ggcgttcgtcgttgccatctgatcagctatcaggaagatggctcgctattacaggaactg
ttctcgcgtgatggtatcggtacgcagatcgtcatggagagcgccgagcagatccgccgc
gctaccatcaacgatattggcggtattctggagcttatccgcccactggaacagcagggc
attctggtacgccgttcccgtgaacaactggagatggagatcgataaatttaccattatt
cagcgcgataatatgactatcgcctgcgcggcgctgtatccttttgtggaagagaaaata
ggcgaaatggcctgcgtagcggtacatccggattaccgcagctcatcgcgtggagaagtg
cttctggagcgggttgccgcccaggcgcggcaaatggggctgcgtaaattgtttgtgctg
acgacgcgcagtattcactggttccaggagcgcggtttcacgcctgtcgatattgagtta
ctgcctgagagcaagaaaaaaatgtataactatcagcgacgttcaaaggtgctgatggcg
gatttagggtaa

DBGET integrated database retrieval system