KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA2721Help
Entry
SSPA2721          CDS       T00756                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSPA2721
Enzymes [BR:sek01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SSPA2721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3022602..3024035
Genome map
AA seq 477 aa AA seqDB search
MRKLTLPKDFLWGGAVAAHQVEGGWNKDGKGPSICDVLTGGAHGVPREITQNVVAGKYYP
NHEAVDFYGHYKEDIRLFAEMGFKCFRTSIAWTRIFPNGDESQPNEAGLKFYDDMFDELL
KYNIEPVITLSHFEMPLHLVQHYGGWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPQMKVGCML
AMVALYPFSCKPEDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMENGDLE
VLREGTCDYLGFSYYMTNAVKAEGGSGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYSL
CELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactcaccttgccaaaagattttttatggggcggcgcggttgctgcacaccag
gttgaaggcggctggaataaagacggtaaaggccccagcatctgcgacgtgctaaccggc
ggcgcacacggcgtgccacgcgaaatcacccagaatgtcgttgctggcaaatactatccg
aaccacgaggcggtggatttttacggacattacaaagaagacatccgtcttttcgccgaa
atggggttcaaatgcttccgtacctctattgcctggacgcgtatcttcccgaatggcgac
gaatcccagccaaacgaggccggtctgaaattctacgacgacatgtttgatgagttactc
aaatacaacatcgaaccggtcattaccctttctcactttgaaatgccattacatctggta
cagcactacggcggctggaccaatcgtaaggtcgttgatttctttgtccgttttgctgaa
gtcgtgtttgaacgctacaaacataaggtcaaatactggatgaccttcaatgaaatcaac
aatcagcgaaactggcgcgcgccgctgtttggctactgctgttccggcgtagtgtatacc
gagcatgagaatccagaagaaaccatgtatcaggtcttacatcatcagtttgtcgccagc
gcgctggcggtaaaagcggcacgtcgtattaatccacagatgaaagttggctgtatgctg
gcgatggtcgcgctgtatcctttctcctgtaaaccagaagatgtgatgtttgctcaggag
tcgatgcgtgaacgctacgtctttaccgatgtacagctgcgcggctactacccgtcctat
gtgttgaacgagtgggagcgccgcggatttaacatcaaaatggaaaatggcgatcttgaa
gtgctgcgcgaaggcacctgcgattatcttggtttcagttattacatgaccaacgcggtc
aaagccgaaggcggtagcggcgatgcgatttccggttttgaaggcagcgtaccgaacccc
tatgttaaagcatctgactggggctggcagattgacccggtgggtctgcgctattcattg
tgtgaactgtacgaacgctatcaaaagccgctatttattgtcgaaaacggttttggtgct
tacgacaaagtagaagaagatggcagcatcaacgacgactatcgcattgactacctgcgc
gcccatattgaagagatgaaaaaagcggtcacttacgatggtgtcgacctgatgggctac
acgccgtggggctgcatcgactgcgtgtcgttcaccaccggtcagtacagcaagcgctac
ggcttcatctacgtgaacaagcacgatgacggtacgggcgatatgtcgcgttcgcgtaag
aaaagcttcaactggtacaaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system