KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA3153Help
Entry
SSPA3153          CDS       T00756                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sek00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3473227..3475305)
Genome map
AA seq 692 aa AA seqDB search
MENKRLDSAALAAGISPSYINAHGKPQSIGAETKRRLLAAMHGTTTGPQAVVPNVKVYTA
GKKMALPVEGRGEFAWLLTTEEGEHYKGRVTGGKKLNLPATLPEGYHTLTLTQDEQRTHC
RIIVAPPRCYEPQALLEGKKLWGACVQLYTLRSEKNWGIGDFGDLKSMLVDVATRGGAFI
GLNPIHALYPVNPESASPYSPSSRRWLNVIYIDVNAVEDFRLSEEAQAWWQMPATQQKLR
QARDAQWVDYATVTALKITALRMAWTRFAARDDAQMAEFRHFIAREGESLYWQAAFDALH
AYQVKEDGQRWGWPAWPEAYQSVESPAVKQFCEAHREEVEFYLWLQWLAWRQFAACWDTC
QSFKLPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDPHI
IVARAYEPFIDLLRANMQNCGALRIDHVMSLLRLWWIPYGETADQGAYVHYPVDDLLSIL
ALESQRHRCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLWFENDLEKNFRAPGAYPQQSMA
VASTHDLPTLRGYWECGDLTLGKALGLYPDEVILRGLYEDRERAKQGLLDALHKYGCLPK
RAGHKAFLMSMTPTLNRGLQRYIADSNSGLLGLQPEDWLDMADPVNVPGTSDQYKNWRRK
LSASLEAMFADEGVNKLIKDLDKRRKAAAKKK
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaacgtctcgatagtgccgcgctggcggcggggatcagccccagttacatc
aatgctcatggcaaaccgcagtctattggcgctgaaaccaagagacgtttgctggcggcg
atgcacggcacgacaacaggaccacaggcggtcgtgccgaatgtgaaggtttataccgcg
ggtaaaaaaatggcgttgccggtagaggggcgcggtgagtttgcctggctgctgactacg
gaagagggcgagcattacaaagggcgcgtgacgggcggtaaaaaacttaacctgccggct
acgttgccggagggctaccacaccctgacgttgacccaggatgaacagcgtacgcactgc
cgtattatcgttgccccgccgcgatgctatgagccgcaggcgctgctggaggggaaaaaa
ctgtggggggcctgcgtccagctttatactctgcgttcagaaaaaaactggggtattggc
gatttcggcgatttgaagtcgatgctggtcgacgtggcgacacgcggcggcgcgtttatc
ggcctgaacccgatccacgcgctttatccggtgaatccggagagcgccagtccctacagc
ccctcgtctcgtcgctggctgaacgtgatatatatcgacgtcaacgccgtcgaagatttc
cgcctgagcgaagaggcgcaggcatggtggcaaatgcccgccacacagcaaaagctgcga
caggcgcgcgatgcgcaatgggtggattacgctaccgttaccgcgctgaaaatcacggcg
ctgcggatggcgtggacgcggtttgccgctcgcgacgatgcgcaaatggcggagtttcgt
cactttatcgcccgcgaaggcgaaagcctttactggcaggcggcattcgacgcgctgcat
gcgtatcaggtgaaagaggatgggcagcgctggggctggccagcctggccggaggcgtac
cagtcggtagagtctcccgctgtaaaacaattctgtgaagcgcaccgcgaagaggtggag
ttttatctctggcttcagtggctggcctggcgccaattcgccgcctgctgggatacctgc
cagagttttaaactaccgattggtctgtaccgcgatctggcggttggcgtagcggaaggc
ggcgcggaaacctggtgcgaccgggagctgtactgcctgaaagcatctgtcggcgcgccg
ccggatatcctcggcccgctcggtcagaactgggggctgccgccgatggacccgcatatc
attgtcgcccgggcgtatgagccctttatcgacctgctgcgcgccaatatgcaaaactgc
ggcgcgttgcgcattgaccatgtcatgtcgttgctgcgcctgtggtggataccgtatggc
gaaacagcggatcagggggcttacgtccattatccggtagatgatttgctttctattctg
gcgctggagagccaacgtcaccgctgtatggtgataggcgaagatctggggacggtgcca
gttgagattgtcggcaagctgcgcgatagcggggtctattcttataaagtgctgtggttt
gaaaatgaccttgagaaaaacttccgcgcgccaggcgcatatccgcaacaatcgatggct
gtcgcctcgacgcacgatctccccacgctgcgcggctattgggaatgcggtgacctgacg
ttgggtaaagctctggggctttatccggatgaagtgattctgcgcgggctgtatgaggat
cgcgagcgggcgaaacaggggctattggacgcgctgcataaatatggctgtctgccaaaa
cgcgccgggcataaggcatttttaatgtcgatgacgccaacgctaaatcgcggacttcag
cgctatatcgccgacagtaacagcggtctgttggggcttcagccggaggactggctggat
atggccgatccggttaacgtaccgggcaccagcgatcagtataaaaactggcggcggaaa
ttgtctgcatctcttgaggctatgtttgccgatgagggcgtaaacaagctgattaaggat
ttggataagcgccgaaaagcggccgcgaagaagaagtaa

DBGET integrated database retrieval system