KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA3536Help
Entry
SSPA3536          CDS       T00756                                 

Definition
(GenBank) detergent-resistant phospholipase A
  KO
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SSPA3536
   00565 Ether lipid metabolism
    SSPA3536
   00590 Arachidonic acid metabolism
    SSPA3536
   00591 Linoleic acid metabolism
    SSPA3536
   00592 alpha-Linolenic acid metabolism
    SSPA3536
Enzymes [BR:sek01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     SSPA3536
    3.1.1.32  phospholipase A1
     SSPA3536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3935639..3936385
Genome map
AA seq 248 aa AA seqDB search
MLQEHDNPFTLYPYDTNYLIYTNTSDLNKEAISTYNWSENARKDEVKFQLSLAFPLWRGI
LGPNSVLGASYTQKSWWQLSNSKESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYN
HDSNGRSDPTSRSWNRLYTRLMAENGNWLVEVKPWYVIGSTDDNPDITKYMGYYQLKIGY
HLGEAVLSAKGQYNWNTGYGGAEVGLSYPVTKHVRLYTQVYSGYGESLIDYNFNQTRVGV
GVMLNDIF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgctacaggagcatgataacccttttacgctttacccttatgacacgaactacttgatc
tacacgaacaccagcgatctgaacaaagaggccataagtacctacaactggtctgaaaac
gcacgtaaagatgaagtgaaatttcagttgagcctggcgtttccgctgtggcgcggaata
ctggggccgaactcggtactgggcgcttcctatacgcagaaatcctggtggcagctttcc
aacagtaaagagtcttcgccgtttcgcgaaaccaactacgaaccgcagctttttcttggt
tttgctaccgattatcgctttgccggctggacgctgcgcgacgtagagatgggctacaac
catgactctaacggacgttcggaccccacctcgcgtagctggaaccgtctgtatacccgt
ctgatggccgaaaacggtaactggctggtagaggtcaaaccatggtacgtgattggcagt
accgacgataatccggacatcaccaaatatatgggttattaccagcttaaaatcggttat
cacctgggcgaggcggtattaagcgccaaaggccagtacaactggaatacaggctacggc
ggcgcggaagttggattaagctatccggtcactaaacatgtccggctttatacccaggtg
tatagcggctatggcgaatcgctgatcgactataattttaatcagacacgtgtcggcgtc
ggcgtgatgcttaacgatatcttctga

DBGET integrated database retrieval system