KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA3615Help
Entry
SSPA3615          CDS       T00756                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sek01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sek00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sek00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:sek00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sek00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:sek00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4027528..4028676)
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDEHQMS
YHLFDEVFPNPTEELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAYS
GVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVML
EIPASVTAATGMDALTHAVEAYVSVGAHPLTDANALEAIRLINLWLPKAVDDGHNLEARE
QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRPNAVARFA
RIAQAMGVETRGMSDEAASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKALADP
CAPCNPRTASRDEVRGLYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttatgttggcactgccaaaaattagcctgcatggcgctggagcgattgccgat
atggtgaacctcgtggcgaataagcaatggggcaaagcgctgatcgttaccgatggtcaa
ctggtaaagctgggcctgctggatagcctgtttagcgcactggatgaacatcaaatgtct
taccacctgtttgatgaggtgttcccaaacccgacagaagagctggtgcagaaaggtttt
gcggcgtatcagagcgcagaatgtgactacattatcgccttcggcggcggcagcccgatc
gataccgcaaaagcggtgaaaattctgaccgccaacccaggtccttctaccgcctactcc
ggcgtcggcaaagtgaaaaacgccggcgtaccgctggtagcgattaatactacggcaggt
accgcggcagagatgaccagcaacgcggtgattatcgactctgcccgtaaggtcaaagag
gtgatcatcgacccgaatatcatcccggatattgccgtggatgacgccagcgtcatgctg
gaaatccccgcttctgtgaccgccgcaaccggcatggatgccctgacccatgcggtggaa
gcctatgtctccgttggcgcgcatccgcttaccgacgctaacgcgctggaagcgattcgc
ttaatcaatttgtggctaccgaaagcggttgacgatggccataacctcgaagcccgtgag
caaatggcattcggccagtacctggcgggtatggcgttcaacagcgccggtttggggctg
gttcacgcgctggcgcaccagccgggcgcaactcacaacctgccgcacggagtctgcaac
gctatcctgctgccaattgtcgagaactttaaccgtccgaacgccgtcgcgcgttttgcc
cgtatcgcacaggcgatgggcgtagagacgcgcggtatgtctgacgaagccgcaagtcag
gaagcgattaacgctatccgtacgctgagcaaacgcgtcggcattccagaaggtttcagc
aagctgggcgtcacaaaagaagatatcgaaggctggctggataaagccctcgccgacccg
tgcgcgccgtgtaacccgcgcaccgccagccgcgatgaagttcgcgggctgtacctggag
gcgttatga

DBGET integrated database retrieval system