KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA3693Help
Entry
SSPA3693          CDS       T00756                                 

Gene name
btuB
Definition
vitamin B12/cobalamin outer membrane transporter
Orthology
K16092  
vitamin B12 transporter
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4117546..4119390
Genome map
AA seq 614 aa AA seqDB search
MIKKATLLTAFSVTAFSAWAQDTSPDTLVVTANRFQQPRSAVLAPVTIVTRQDIERWQST
SVNDVLRRLPGVDIAQSGGAGQNSSIFIRGTNSSHVLVLIDGVRLNLAGVSGSADLSQFP
VSLVQRIEYIRGPRSAIYGSDAIGGVVNIITTRDNPGTELTAGWGSNSYQNYDISTQQQL
GENTRATLIGDYEYTKGFDVVAKGGTGMQAQPDRDGFLSKTLYGALEHTFSDRWSGFVRG
YGYDNRTDYDAYYSPGSPLIDTRKLYSQSWDAGLRFNGERIQSQLVSSYSHSKDYNYDPH
YGRYDTSATLDEMKQYNVQWTNSVVVGHGNVGAGVDWQKQTTTPGTGYVPEGYDQRNTGV
YLTGLQQLGDFTLEAAARSDDNSQFGRHGTWQTSAGWEFIEGYRFIASYGTSYKAPNLGQ
LYGYYGNPNLNPEKSKQWEGAFEGLTAGVSWRISGYRNDINDMIDYDDHLQKYYNEGKAR
IKGIEATANFDTGPLTHTVSYDYVDARNAITDTPLPRRSKQMAKYQLDWDVYDFDWGVTY
QYLGSRYDSDYSAYPYRTVKMGGVSLWDLTVAYPVTSHLTVRGKIANLFDKDYETVYGYQ
TAGREYTLSGSYTF
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagctacgctgctgacggcgttctccgtcacggccttttccgcttgggcg
caggacactagcccggataccctggttgtcaccgccaaccgttttcagcagccgcgcagc
gcggttctggcgcccgttaccatcgtgacgcgtcaggatattgaacgctggcaatcgacc
tccgtaaatgatgttctgcgccgtttgcctggcgtcgatattgcgcagagcggcggcgcc
ggacaaaactcctccattttcattcgcggcaccaactccagccatgtactggtattgatt
gacggcgtgcgtctgaatttagcaggcgtgagcgggtccgccgatctcagccagttcccg
gtgtcgctggtacagcgcattgaatatattcgcggtccgcgctccgctatttatggttcc
gatgctatcggcggcgtagtgaatatcattacgacgcgcgataacccaggcacagaatta
accgctggatggggaagcaatagctaccagaattacgacatctcgacgcaacagcaactt
ggcgaaaacacgcgggcgacgttgatcggcgattacgaatacaccaaagggtttgacgtg
gtagcgaaaggcggtaccgggatgcaggcgcagcctgaccgggacggctttttgagtaaa
acgctttatggcgcgttagagcataccttttctgatcgctggagcggattcgtgcgtggt
tatggctacgataaccgtaccgattacgacgcctattactcgccgggctcgccgctgatt
gatacacgcaaactttatagccaaagctgggacgccgggctgcgctttaatggcgaacgt
attcagtctcagctggtttcaagctatagccacagtaaagattacaactatgatccgcac
tatggccggtatgatacctccgccacgctggatgagatgaaacagtacaatgttcaatgg
accaacagtgtggtcgtggggcacggtaatgttggggcgggcgtagactggcagaaacag
actaccacgccaggtaccggctatgtgcccgagggatatgaccagcgtaataccggggtt
tacctgacaggattacaacagttgggtgacttcactctggaagcggcggcgcgcagtgat
gacaactcccagtttggtcgtcatggtacatggcaaaccagcgcgggatgggagtttata
gaaggttatcgctttattgcctcctacggaacctcctacaaagcgcctaatttgggccag
ctgtatgggtattacggtaatccgaacctgaatcctgaaaagagtaaacagtgggaaggc
gcatttgaagggctcaccgctggcgtcagctggcgtatttcaggttatcgtaacgatatt
aatgacatgatcgattatgacgatcatctgcaaaaatattacaacgaaggcaaggcgcgc
attaaaggtattgaggcgacggcgaatttcgataccggaccgttaacgcatacggtcagt
tatgattacgttgatgcgcgtaatgcgattaccgatacgccattaccccggcgttccaaa
cagatggcaaaatatcaacttgactgggacgtttacgattttgactggggggtgacatat
caataccttggttcccgctatgattcggattactccgcttacccataccggacagtaaaa
atgggcggcgtcagtttatgggatcttacggttgcatatccggtcacctcacatctgaca
gttcgtggtaaaatagccaacctgttcgacaaagattacgagacagtttatggctaccaa
actgcaggacgagaatacaccttgtctggcagctacaccttctga

DBGET integrated database retrieval system