KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA3922Help
Entry
SSPA3922          CDS       T00756                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SSPA3922
Enzymes [BR:sek01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SSPA3922
Transfer RNA biogenesis [BR:sek03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SSPA3922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4388857..4389597
Genome map
AA seq 246 aa AA seqDB search
MLEQVCQLARNAGDAIMQVYDGAKPMEYARKQDDSPVTAADIAAHTVILEGLRTLTPDIP
VLSEEDPPAWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEQGKPVLGVVYAPVL
KVMYYAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHTDDELTEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTSVWDTAAGHAIAVAAGAHVHDWQGKTLDYTPRESFLNPG
FRVTIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagtatgccagcttgcacggaacgcgggcgatgccattatgcaggtttat
gatggagccaaaccgatggagtacgcccgcaagcaggacgattctccagtcactgcggcg
gatatcgccgcacataccgtgattctcgaagggttacgcacgctcacgccggatattccg
gtgctttcagaagaagatccgcccgcctgggaagtgcgccagcactggcagcgttactgg
ctggtcgatccgctcgacggcaccaaagaattcatcaagcgcaatggagaattcacggtc
aatatcgcgctgattgagcagggcaagccggtgttgggcgttgtctatgcgccggtgctg
aaagtgatgtactacgcggcggaaggtaaggcctggaaagaggagtgcggggtgcgtaag
cagattcaggtgcgggatgcccgcccgccgctggtggtgattagccgttcgcatacggat
gatgaactcaccgaatatctccaacagcttggcgaacatcagaccacctctattggttcc
tcgctgaaattctgtcttgtggcggaaggacaggcgcagctttaccccagatttgggccg
accagcgtctgggatactgccgcaggtcatgccattgccgttgcagccggggcgcacgtt
cacgactggcagggaaaaacgctggactatacccctcgtgaatcgttccttaaccccggc
ttccgggtgactatttactga

DBGET integrated database retrieval system