KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_0004Help
Entry
SPUL_0004         CDS       T01740                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00260  Glycine, serine and threonine metabolism
sel00750  Vitamin B6 metabolism
sel01100  Metabolic pathways
sel01110  Biosynthesis of secondary metabolites
sel01120  Microbial metabolism in diverse environments
sel01230  Biosynthesis of amino acids
Module
sel_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sel00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPUL_0004 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPUL_0004 (thrC)
Enzymes [BR:sel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SPUL_0004 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AET52465
Position
3734..5020
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHELPEFSLTEIDEMLNQDFVSRSAKILS
AFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQICYYFEAVAQLPQGARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNINDTVPRFLQDGKWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTMRELKAKGYISEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEALAERADLPLLSHHLPADFAAL
RKLMMTRQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctataatctgaaagaccataatgagcaggtcagctttgcgcaggccgtcacg
caagggctgggcaaacagcagggacttttttttccgcacgaactgccggagtttagcctg
acggaaattgatgagatgctcaaccaggactttgtcagccgtagcgcaaagatcctctcg
gcatttattggcgatgaaataccgcagcaaattctggaagagcgcgtccgcgcggcgttt
gctttcccggcgccggtagcgcaggtagaaagcgatgtcggctgcctggagctgttccat
ggtccgacgctggcctttaaagacttcggcgggcgttttatggcgcaaatgctgacgcat
atcagcggcgacaaaccggtgacgattctgaccgcaacgtcaggcgataccggcgcggcg
gtggctcacgcgttctatggcctggaaaatgtgcgggtcgtcattctctatccgcgcggt
aaaatcagtccgttgcaggaaaaactgttctgtactctgggcggcaacattgaaaccgta
gcgatcgacggcgatttcgacgcttgccaggcgctggtgaaacaggcatttgatgacgaa
gaactgaaaacggcgctggggctgaattcagctaattcgattaatatcagccgcctgctg
gcgcaaatttgctactactttgaagccgtggcgcaactgccgcagggggcgcgtaaccaa
ctggtgatctccgtacccagcggcaactttggcgatttgacggcaggactgctggcgaag
tcgttaggcctaccggtgaaacgctttatcgccgccaccaacattaacgatacggtgccg
cgtttcctgcaggacgggaagtgggcgccaaaagcgacgcaggcgaccctgtcgaatgcg
atggatgtcagccagccgaataactggccgcgtgtggaggagctattccgccgtaaaatc
tggcgtctgactgagctgggctatgcggcggtggatgacactacgacacaacagacgatg
cgcgagctgaaagcgaaaggttatatctcggaacctcatgcggcggtagcgtatcgggca
ttacgcgaccagttaaaccctggcgagtatggcttgtttctcggaacggcgcatccggcg
aagtttaaagaaagcgtggagtccattctgggagaaacgctggccttgcctgaagcgctc
gccgaacgcgccgacctgccgctgctttcacatcatctgcctgcggattttgccgccctg
cgtaagctgatgatgacccgccagtaa

DBGET integrated database retrieval system