KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_0165Help
Entry
SPUL_0165         CDS       T01740                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:sel01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sel00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sel00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sel00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
180519..182402
Genome map
AA seq 627 aa AA seqDB search
MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGALIMIFDSADGAADAAPAQAEEKKEATPAAAPAAAAAKDVHVPDIGSDEVEV
TEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNTGDKVSTGSLIMVFEVA
GAAPAAAPAKAEAAPAAPAAATGVKDVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLITVE
GDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAPAKQEAAAPAPAAK
AEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDVQA
YVKDAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWVMI
PHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFNSSLSE
DGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSVTELSRELTTISKKARDGKLTAGEM
QGGCFTISSIGGLGTTHFAPIVNAPEVAILGISKSAMEPVWNGKEFVPRLMMPISLSFDH
RVIDGADGARFITIINNMLSDIRRLVM
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcgggacagatgaagttgaaatcaccgagatt
ctggtcaaagtgggcgacaaagtggaagctgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagtcccgtctccgcaggctggcgtcgtgaaagagatcaaagtctct
gtcggcgacaaaaccgagaccggtgcacttatcatgattttcgattccgccgacggtgca
gctgacgctgcgcctgctcaggcagaagagaagaaagaagcgactccggcagcagcacct
gctgcggcagcggcgaaagacgttcacgttccggatatcggcagtgacgaagttgaagtg
actgaagtgatggtgaaagtgggcgacaccgttgaagctgaacagtcgctgatcaccgtc
gaaggcgacaaggcctctatggaagtgccggcgccgttcgcgggcaccgtgaaagagatc
aaagtgaacaccggtgataaagtgtctaccggctcactgattatggtcttcgaagtggcg
ggcgcagcgcctgccgcagcaccagcgaaagcggaagccgctccggctgctccagcagca
gcgacgggcgtgaaagacgttaacgtaccggatatcggcggcgacgaagttgaagtcacc
gaagtgatggtcaaagtcggcgataaagttgccgctgaacagtcgctgatcaccgtcgaa
ggcgacaaggcctctatggaagttcctgcgccgttcgcgggcaccgtgaaagaaatcaaa
atcagcaccggcgataaagtgaaaaccggctctctgattatggtcttcgaagtagaaggc
gcagcgcctgcggccgctccggctaaacaggaagcggcggcaccggctccggcggcgaaa
gctgagaagcctgctgccccggctgccaaagcggaaggcaaatctgagttcgctgaaaac
gacgcttacgttcacgctaccccgctgattcgccgcctggcgcgcgagtttggcgtaaac
ctggcgaaagtgaaaggcaccggtcgtaaaggccgtattctgcgcgaagacgttcaggct
tacgtgaaagacgcaatcaaacgcgcggaagctgcaccggctgctgcgggcggtggtatc
ccgggtatgctgccgtggccgaaagtggacttcagcaagtttggtgaagttgaagaagtg
gagctgggccgtatccagaaaatctctggcgcgaacctgagccgtaactgggtgatgatc
ccgcacgttacgcacttcgacaaaaccgatatcaccgatctggaagcgttccgtaaacag
cagaacgccgaagctgagaagcgcaaactggatgtgaaatacacgccagtggtcttcatc
atgaaagcggttgccgctgctctggaacagatgccgcgcttcaacagctctctgtccgaa
gacggtcagcgtctgaccctgaaaaaatacatcaacatcggcgtggcggttgataccccg
aatggcctggtggttccggtctttaaagacgtgaataagaagagcgtgaccgagctgtct
cgtgaactgaccaccatctccaaaaaagcgcgtgatggtaagctgaccgctggcgaaatg
cagggtggttgcttcactatctccagcatcggcggcctgggaactacccactttgcgccg
attgtcaacgcgccggaagtggctatcctcggcatttctaagtcggcgatggaaccggtg
tggaatgggaaagagtttgtgccgcgtctgatgatgcctatctctctttctttcgaccac
cgtgtgatcgatggtgctgatggtgcgcgtttcattaccattatcaacaatatgttgtct
gacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system