KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_0496Help
Entry
SPUL_0496         CDS       T01740                                 

Gene name
yfcX
Definition
putative fatty acid oxidation complex alpha subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPUL_0496 (yfcX)
   01212 Fatty acid metabolism
    SPUL_0496 (yfcX)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SPUL_0496 (yfcX)
   00650 Butanoate metabolism
    SPUL_0496 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    SPUL_0496 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    SPUL_0496 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPUL_0496 (yfcX)
   00310 Lysine degradation
    SPUL_0496 (yfcX)
   00380 Tryptophan metabolism
    SPUL_0496 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPUL_0496 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SPUL_0496 (yfcX)
   00281 Geraniol degradation
    SPUL_0496 (yfcX)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SPUL_0496 (yfcX)
Enzymes [BR:sel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SPUL_0496 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SPUL_0496 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SPUL_0496 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
549691..551838
Genome map
AA seq 715 aa AA seqDB search
MTTTSAFMLNVRLDNVAVVAIDVPGEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISA
KADNFIAGADINMIGHCQNAQEAETLARQGQQLMAEIQALPVPVIAAIHGACLGGGLEMA
LACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQAL
KAGLVDDVVPQTILLEAAVELAKKERLAQRTLPVRERILAGPLGRALLFRLVRKKTAQKT
QGNYPATERIIDVIETGLAQGSSSGYDAEARAFGELAMTPQSQALRAVFFASTEVKKDPG
SDAPPGPLNSVGILGGGLMGGGIAWVTACKGGLPVRIKDINTQGINHALKYSWDLLETKV
RRRHIKANERDKQLALISGSTDYRGFSHRDLVIEAVFEDLPLKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAANAARPEQVIGLHFFSPVEKMPLVEVIPHASTSAQTIATTVKLAKKQ
GKTPIVVSDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAEYGERFSAPANVVASILNDDRKGRKNGRGFYLYGEKGRKSKKQVDPA
IYKLIGVQGQSRLSAQQVAERCVMLMLNEAARCFDEKVIRSARDGDIGAVFGIGFPPFLG
GPFRYMDALGPGEMVATLQRLAALYGPRYAPCEQLVRMAERREHFWTNGETDQGN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgactaccacatcagcttttatgcttaacgtgcgtctggataatgtcgcggttgtcgct
attgatgtccctggagaaaaggtgaacaccctgaaagcggagtttgccgcgcaggtacgc
gccatcctgaagcagatccgggaaaataaagcgttgcagggcgttgtttttatctcagcc
aaagcagataactttattgctggcgctgatatcaacatgataggtcactgccaaaacgcg
caggaagcggaaacgctggcgcgtcaggggcaacaactgatggcggagatccaggcgttg
cctgttccggttatcgccgccattcatggcgcctgtctggggggcggccttgaaatggcg
ctggcctgccatcgacgtatctgtaccgacgacgttaaaaccgttctcggactgccggag
gtacagttagggcttttaccgggatcgggcggaacgcagcgacttccacggctggtgggg
gtcagtaccgcgctggatatgatcctgacaggtaaacagcttcgcgccaggcaggcgctt
aaagccgggctggttgatgatgtggtgccgcaaactattttactggaagcggctgtcgag
ctggctaaaaaagaacgcctggcgcagcggacattaccggtccgtgaacgtatcctggcg
gggccgctggggcgcgcgctgttatttcgcctggtgcgtaaaaagacagcgcaaaaaacg
cagggtaattatccggcgacggagcggatcattgatgtgattgaaaccggactggcgcag
ggcagcagtagcggctatgacgcggaagcgcgcgctttcggcgagctggcgatgacgcct
caatcgcaggcgctgcgcgctgttttctttgccagtaccgaggtgaaaaaagatcccggt
agcgatgcgccgcccggcccgctgaacagcgtgggcatcttaggcggcgggttaatgggc
ggcggtatcgcctgggttacggcctgtaaaggcggtttgccagtacgaattaaggatata
aatactcaggggatcaatcatgctctgaaatacagctgggatctgcttgaaacaaaagta
cgccgccgccatatcaaagccaacgaacgcgataaacagttggcattgatatcaggttcg
accgattaccgtggtttcagtcatcgtgatctggtcattgaagcggtgtttgaagatctg
ccgttaaaacaacagatggtggcggaagtggaacaaaattgcgctgctcacaccattttt
gcctccaatacttcttccctgccgattggcgatattgcggcgaatgcggccagaccggaa
caggtgattggattgcacttttttagcccggtcgaaaaaatgccgctggttgaggttatt
cctcatgcgtctacttccgcgcagaccatcgccacgaccgttaagctggcgaaaaaacag
ggtaaaaccccgatagtcgtcagtgataaagccgggttttatgttaaccgaattcttgcg
ccatatatcaatgaggcgattcggatgctgactgaaggcgaacgcgtcgaacatattgac
gccgccctggtaaaatttggttttccggtggggccaatccaacttttggatgaggtagga
atcgacacgggcactaaaattattcctgtgcttgaggcggagtatggagaacgttttagc
gcgcctgcaaatgttgtcgcttcaattttgaatgacgatcgcaaaggtagaaaaaatggt
cgcggtttctatctttatggcgaaaaagggcgtaaaagcaaaaaacaggttgaccctgct
atttataagcttattggcgtgcaagggcagagtcgattgtctgcgcagcaggtggcagag
cgctgtgtcatgttaatgcttaacgaagcggcgcgctgtttcgacgaaaaagtgattcgc
agcgcgcgcgatggcgatatcggcgccgtgtttggtatcggttttccgccgtttctcggt
ggcccgttccgctatatggatgctctcgggccgggtgaaatggtggcgacattacagcgc
ctggccgcactttacggtcctcgttacgcgccttgtgaacaattagtgcgcatggcggag
cgcagggagcatttctggacgaatggggaaactgaccagggaaattga

DBGET integrated database retrieval system