KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1157Help
Entry
SPUL_1157         CDS       T01740                                 

Gene name
btuE
Definition
putative glutathione peroxidase/vitamin B12 transport periplasmic protein BtuE
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sel00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sel00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1185905..1186456
Genome map
AA seq 183 aa AA seqDB search
MQNSLLNTHVTTIDGEVTTLEKYAGKVLLIVNVASRCGLTPQYEQLENIQKAWADQGFVV
LGFPCNQFMGQEPGSEEEIKTYCASTWGVTFPMFSKIDVNGDARHPLYQKLIAAAPTAVA
PEKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQRFSPDMTPEDPIVMESIKIT
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaactcgcttcttaatactcacgttacgacgattgatggagaggtcactacactt
gaaaaatacgccggaaaagtgctgctcattgtaaacgtcgcctccagatgtggcctgact
ccgcaatatgaacagttggaaaatatccagaaggcgtgggcagatcaggggtttgtcgtg
ttgggttttccctgcaaccagtttatggggcaggagccaggcagcgaagaggagattaaa
acctattgtgccagcacctggggcgtcacgttcccgatgttcagtaaaattgatgtgaat
ggcgacgcgcgccatccgctgtatcaaaaactgatagccgctgcgccaacggcagtcgcg
ccggagaagagcggcttttacgaacggatggtaagcaaagggcgtacgccactctatccg
gatgatattctgtggaattttgaaaaatttttggtaggccgggatggtcaggtggtacag
cgtttttcgccggatatgacgcctgaagatcctattgtgatggaaagcataaaaatcacg
ttggcaaaataa

DBGET integrated database retrieval system