KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1343Help
Entry
SPUL_1343         CDS       T01740                                 

Gene name
yneH
Definition
putative glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sel00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPUL_1343 (yneH)
   00330 Arginine and proline metabolism
    SPUL_1343 (yneH)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SPUL_1343 (yneH)
Enzymes [BR:sel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SPUL_1343 (yneH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1367603..1368529
Genome map
AA seq 308 aa AA seqDB search
MAWAMDNAILETILQRVRPLIGQGKVADYIPALASVEGSKLGIAICTVDGQHYQAGDAHE
RFSIQSISKVLSLVVAMRHYPEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRALCGVSDITYDATVARSEFEHSARNAAIAWLMKSFGN
FHHDVPTVLQNYFHYCALKMSCMELARTFVFLANQGEAFHLDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAALEQLT
QTLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggcctgggccatggataatgcaattttagagacgattttacagcgcgttcgccccctc
attggccagggcaaagtcgctgactatattccggcattagcgtccgtcgagggttcaaag
ctggggatagcgatttgtaccgtggacgggcagcattatcaggcgggcgatgcgcacgaa
cgcttctctattcagtctatttcgaaagtgctcagtctggtggtggcgatgcgtcattat
ccggaagaggagatctggcagcgcgtcggaaaagatccttccggctcgccgttcaattcg
ttggttcagttagagatggaacaaggcatcccgcgtaatccatttattaatgcgggcgcg
ctggtggtatgcgacatgttgcaaggccggcttagcgcgccgcgtcagcggatgctggaa
gttgtgcgcgcgctttgcggcgtatcggatattacgtatgacgctacggtcgcgcgctct
gaatttgagcattccgcccgtaacgccgctattgcctggctgatgaaatcattcggtaat
tttcatcatgatgtgcctaccgtgttgcaaaattacttccactactgtgcgttgaaaatg
agctgcatggaactggcgaggacgtttgtctttctggcgaatcagggcgaggcgtttcat
ctcgacgagccggtagtgacccccatgcaggcccggcaaattaatgcgctaatggcgacc
agcgggatgtatcagaatgccggagagtttgcctggcgggtaggattgcccgctaaatcc
ggcgtgggcggtggtattgtcgccattgtgccgcatgaaatggcgattgccgtctggagt
ccggagctggatcctgcgggaaactctctggcaggtatcgccgcgcttgaacaattaaca
caaacgttaggacgttcggtatactga

DBGET integrated database retrieval system