KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1375Help
Entry
SPUL_1375         CDS       T01740                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sel00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SPUL_1375 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPUL_1375 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SPUL_1375 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPUL_1375 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPUL_1375 (adhP)
   00626 Naphthalene degradation
    SPUL_1375 (adhP)
Enzymes [BR:sel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPUL_1375 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1399151..1400161
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHQVDVTEKTLRPLRHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNTGNETLCRNVKNAGYTVDGGMAEE
CIVVADYAVKVPEGLDSAAASSITCAGVTTYKGVKISHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLKLAEEMGADLTINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMNLDIPRLVLDGIQVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLEDINVIFKEMEQGQIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttgtcacacaagatcatcaggttgatgttactgagaaaacgctgcgt
ccccttcgccacggtgaagctttgctaaaaatggagtgctgcggcgtatgccataccgat
ctacacgtgaaaaacggcgatttcggtgacaaaaccggcgtcattctgggacacgaaggc
attggcgtcgtggcggaagtcggtcctggtgtcacctcgctgaaacccggcgatcgcgcg
agtgtcgcgtggttttatgaaggatgcggacactgtgagtattgcaatacgggcaatgaa
accttatgccgcaacgtgaaaaatgccggttacacggtagatggcggcatggccgaagag
tgtattgtcgtcgcggattatgcggtgaaagtaccggaaggtctggactctgcggcggca
agtagtattacctgcgcgggcgttaccacgtataaaggggtgaagatttctcatattaaa
cctggccagtggattgccatctacggtctgggcggtctgggtaatctggccttgcagtac
gcgaaaaacgttttcaatgcgaaagtgatcgccattgatgtcaatgatggacaactgaaa
ctggccgaggaaatgggcgcagatctgaccattaattcacgtacggaagatgcggctaaa
attgtgcaggaaaaaaccggtggcgcgcacgcagcggtggttaccgcggtcgctaaggcg
gcgtttaattccgcagtagatgccgttcgcgccggaggtcgcgtggtggcagtcgggctg
ccgccagaagccatgaaccttgatatccctcgcctggtgctggatggaattcaggttgtc
ggttcgttggtggggacacgccaggatctgaccgaagccttccagttcgcggcggaagga
aaagtcgtgccaaaagtcgctttacgtccgcttgaagatatcaacgttatttttaaagag
atggaacaagggcaaattcgtggccgtatggtcatcgatttccgtcgttaa

DBGET integrated database retrieval system