KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_3032Help
Entry
SPUL_3032         CDS       T01740                                 

Gene name
yqeF
Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sel00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPUL_3032 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    SPUL_3032 (yqeF)
   00640 Propanoate metabolism
    SPUL_3032 (yqeF)
   00650 Butanoate metabolism
    SPUL_3032 (yqeF)
  Lipid metabolism
   00071 Fatty acid degradation
    SPUL_3032 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    SPUL_3032 (yqeF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPUL_3032 (yqeF)
   00310 Lysine degradation
    SPUL_3032 (yqeF)
   00380 Tryptophan metabolism
    SPUL_3032 (yqeF)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPUL_3032 (yqeF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPUL_3032 (yqeF)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SPUL_3032 (yqeF)
Enzymes [BR:sel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPUL_3032 (yqeF)
Exosome [BR:sel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPUL_3032 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3044997..3046175)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGFKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtgctgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gccattactattaatgacgtttgtggttccggtttcaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttattgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccgggcgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcccattggcgcttccggttgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggtctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system