KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_3475Help
Entry
SPUL_3475         CDS       T01740                                 

Gene name
pldA
Definition
(GenBank) detergent-resistant phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00564  Glycerophospholipid metabolism
sel00565  Ether lipid metabolism
sel00590  Arachidonic acid metabolism
sel00592  alpha-Linolenic acid metabolism
sel01100  Metabolic pathways
sel01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sel00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPUL_3475 (pldA)
   00565 Ether lipid metabolism
    SPUL_3475 (pldA)
   00590 Arachidonic acid metabolism
    SPUL_3475 (pldA)
   00591 Linoleic acid metabolism
    SPUL_3475 (pldA)
   00592 alpha-Linolenic acid metabolism
    SPUL_3475 (pldA)
Enzymes [BR:sel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     SPUL_3475 (pldA)
    3.1.1.32  phospholipase A1
     SPUL_3475 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: AET55733
Structure
PDB: 

Jmol
Position
complement(3493393..3494262)
Genome map
AA seq 289 aa AA seqDB search
MRAILRGLLPATLLPLAAYAQEATIKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTNTSDLNKEAISTYNWSENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSKESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVIGSTDDNPDITKYMGYYQLKIGYHLGEAVLSAKGQYNWNTGY
GGAEVGLSYPVTKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDIF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgattttgagagggttgttgccagccacgctactgccattagcggcatatgca
caagaagctacgataaaagaggttcatgatgcgcctgcagtacggggaagtatcatcgct
aacatgctacaggagcatgataacccttttacgctttacccttatgacacgaactacttg
atctacacgaacaccagcgatctgaacaaagaggccataagtacctacaactggtctgaa
aacgcacgtaaagatgaagtgaaatttcagttgagcctggcgtttccgctgtggcgcgga
atactggggccgaactcggtactgggcgcttcctatacgcagaaatcctggtggcagctt
tccaacagtaaagagtcttcgccgtttcgcgaaaccaactacgaaccgcagctttttctt
ggttttgctaccgattatcgctttgccggctggacgctgcgcgacgtagagatgggctac
aaccatgactctaacggacgttcggaccccacctcgcgtagctggaaccgtctgtatacc
cgtctgatggccgaaaacggtaactggctggtagaggtcaaaccgtggtacgtgattggc
agtaccgacgataatccggacatcaccaaatatatgggttattaccagcttaaaatcggt
tatcacctgggcgaggcggtattaagcgccaaaggccagtacaactggaatacaggctac
ggcggcgcggaagttggattaagctatccggtcaccaaacatgtccggctttatacccag
gtgtacagcggctatggcgaatcgctgatcgactataattttaatcagacacgtgtcggc
gtcggcgtgatgcttaacgatatcttctga

DBGET integrated database retrieval system