KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_3774Help
Entry
SPUL_3774         CDS       T01740                                 

Definition
putative carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sel00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SPUL_3774
Enzymes [BR:sel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SPUL_3774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3810551..3811471
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLITYTNQMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSKVLMLTKV
GDDIFADNTIRNLESWGINTTYVEKVPCTSSGVAPIFVNANSSNSILIIKGANKFLSPED
IDRAAEDLKKCQLIVLQLEVQLETVYHAIEFGKKHGIEVLLNPAPALRELDMSYACKCDF
FVPNETELEILTGMPVDTYDHIRAAARSLVDKGLNNIIVTMGEKGALWMTRDQEVHVPAF
RVNAVDTSGAGDAFIGCFAHYYVQSGDVEAAMKKAVLFAAFSVTGKGTQSSYPSIEQFNE
YLSLNE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcggttattggctctaacatggtggaccttatcacctacaccaaccagatg
cccaaagaaggggaaactctggaagcgccggcgtttaaaatcggctgcggcggaaaaggg
gcgaaccaggccgtggcggccgctaagctcaattcaaaagtattgatgttgaccaaagtg
ggcgacgatatttttgccgacaacaccattcgtaatctcgaatcctgggggatcaatacg
acgtatgtagaaaaagtaccgtgtaccagcagcggcgtagcgccgattttcgtcaacgcc
aactccagcaacagcattctgatcatcaaaggcgccaacaagtttctctcgccggaagat
atcgatcgcgcggcggaagatttaaaaaaatgccagcttattgttctgcaactggaagtt
cagcttgaaacggtttatcacgcaatagaatttggcaagaaacatgggattgaagtgtta
ttaaaccctgcgccagcattacgggaattagatatgtcttatgcctgtaaatgcgatttc
tttgtacccaatgaaaccgagctggaaatattaaccggtatgccagtggatacctatgac
catattcgcgcagcggcacgttcgctggtggataaagggctgaacaatattatcgtcacc
atgggtgagaaaggcgcgctgtggatgacgcgtgaccaggaagtccatgtcccggcgttt
agagtgaacgctgtcgataccagcggcgcgggcgatgcctttatcggctgtttcgcgcat
tactacgtccagagcggggatgtggaagccgccatgaaaaaagccgtcctctttgccgct
ttcagcgtcaccgggaaaggcacccaatcctcttatccaagcattgaacaatttaatgag
tatctttcgttgaacgaataa

DBGET integrated database retrieval system