KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C01840Help
Entry
STMDT12_C01840    CDS       T01742                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sem00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
complement(213398..213877)
Genome map
AA seq 159 aa AA seqDB search
MTIAYIALGSNLASPLEQVNAALKAIADIPDSRIVAVSSFYRTPPLGPQDQPDYLNAAVA
LDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDEVINTDRLTVPHYDMK
NRGFMLWPLFEIAPDLIFPDGISLHQHLTHLGAAKPAHW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgcgtatatcgcgcttggcagtaatctggcctctccgctggagcaggtcaat
gccgccctgaaggctatcgccgacattcccgatagccgtatcgtcgcggtttcttcgttt
taccgcacgccgccgcttggcccacaggatcagcccgattacctgaacgctgcggtggcg
ctggataccgctctcgcccccgaagaattgcttaaccatacccagcgcattgagctgcaa
cagggccgggtgcgcaaagccgaacgctgggggccgcgcacgctggatctcgacattatg
ctgtttggcgatgaagtcattaacaccgaccgtctgaccgtgccgcactacgacatgaaa
aaccgcggttttatgctgtggccgttattcgaaatcgctcctgatctgatctttccggat
ggtatcagcctgcatcagcatctcacccatcttggtgctgcaaaacccgcccactggtaa

DBGET integrated database retrieval system