KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C02210Help
Entry
STMDT12_C02210    CDS       T01742                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00900  Terpenoid backbone biosynthesis
sem01100  Metabolic pathways
sem01110  Biosynthesis of secondary metabolites
sem01130  Biosynthesis of antibiotics
Module
sem_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STMDT12_C02210
Enzymes [BR:sem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     STMDT12_C02210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: BAJ35164
NITE: STMDT12_C02210
Position
257847..259043
Genome map
AA seq 398 aa AA seqDB search
MKQLTILGSTGSIGCSTLDVVRHNPDSFRVIALVAGKNVARMAEQCLEFSPRYAVMDDTS
SAEQLKIMLQQHGSRTEVLSGQQAACEMAALDEVGHVMAAIVGAAGLLPTLAAIRAGKTI
LLANKESLVTCGRLFMDEVKRSNARLLPVDSEHNAIFQSLPQSIQHNLGYADLEQNGVTS
ILLTGSGGPFRETPMCDLAAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASARQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVTSGAQPLDFC
KLSALTFSAPDYQRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAGLN
LAVLERMDLQEPASVEDVLQVDAIAREVARKQVIRLSR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattaaccattctgggctcgaccggctctattggttgcagcacactggacgtg
gtgcgccataatcctgatagcttccgcgttatcgcgctggtggcgggtaaaaatgtcgcc
cgcatggcggagcagtgcctggagttctcgccgcgttatgccgtgatggacgatacgtcg
agcgcagaacagctcaaaataatgcttcagcagcatggcagccgcaccgaggttctgagc
ggtcagcaggctgcctgtgagatggcggcgcttgatgaggtcgggcatgtgatggcggcc
attgtgggcgcggctggtttactgccgaccctggcggcgattcgcgcagggaagacgatt
ctgctggcgaataaagaatcgctggtgacctgcgggcggctgtttatggacgaagtaaaa
cgcagcaacgcccggcttttacccgtcgatagcgaacataacgcgatttttcagagtttg
ccgcaatctattcagcataatctgggatacgctgaccttgagcaaaatggcgtaacgtcg
attttgcttaccgggtctggtggcccgtttcgtgaaacgcccatgtgcgatctggcagcg
atgacgccggatcaggcatgtcgtcatccgaactggtcgatggggcgaaaaatctccgtc
gactccgccaccatgatgaataaaggtctggaatacattgaagcgcgttggttatttaat
gccagcgcacgtcagatggaagtgttgatccatccgcaatcggtcattcattcgatggtg
cgttatcaggacggcagcgtcctggcgcagcttggagaacctgacatgcgtacgcctatt
gcgcatacgatggcatggccgaatcgcgtcacgtccggcgcgcagccgctcgatttttgc
aaactcagcgcgctgacgtttagcgcgccagattatcagcgttatccttgcctgaagctg
gcgatggaggcgtttgagcaaggtcaggcggcaacgacggcgctcaatgcggcaaacgaa
atcaccgttgccgcgtttctggcgcaacagattcgttttaccgatatcgccgggctcaat
ttagcggtgctggagaggatggatttacaggaaccggcaagcgttgaggacgtattgcag
gttgacgccatcgcgcgtgaagtagccagaaaacaagtgatacggctctcacgctga

DBGET integrated database retrieval system