KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C03650Help
Entry
STMDT12_C03650    CDS       T01742                                 

Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
387251..387721
Genome map
AA seq 156 aa AA seqDB search
MAAISGGAIAIASVLITGPGGNDGLEGVRYKPYKDVVGVLTVCYGHTGKDIMPGKTYTEA
ECKALLNKDLITVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIK
GACDQLRRWTYAGGKQWKGLMTRREVERDVCLWGKQ
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgataagtggcggggctattgctatagcatctgtgttaatcactggccccggt
ggtaacgatggtctggaaggtgtcagatacaaaccatataaggacgtagtcggtgtgttg
actgtgtgttatggccacaccggaaaagacatcatgcctggtaaaacgtataccgaagca
gaatgcaaagccctcctgaataaagaccttatcactgtcgccagacaaattaacccgtac
atcaaagtagatataccggaaacaacgcgcggcgctctttactcgttcgtttacaatgtg
ggcgcaggcaatttcagaacatcgacgcttcttcgcaaaatcaatcagggtgatatcaaa
ggtgcatgtgatcagctacgtcgctggacatacgctggcggtaagcaatggaaaggcctg
atgactcgtcgtgaggttgagcgtgatgtctgtttgtggggtaagcaatga

DBGET integrated database retrieval system