KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C05490Help
Entry
STMDT12_C05490    CDS       T01742                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sem00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    STMDT12_C05490 (recR)
DNA repair and recombination proteins [BR:sem03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      STMDT12_C05490 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
581257..581862
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLASEKISELILATNPTVEGEATANYIAELCAEAGVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIIF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccgctgttaactcagcttatggaagcgttgcgctgccttccgggcgtt
ggccctaagtcggcgcagcggatggcgtttaccctgttgcagcgcgatcgcagcggcgga
atgcgcctggcgcaggcgctgactcgggcgatgtcggaaatcggccactgcgccgactgc
cgcacctttaccgagcaggatgtttgtaatatctgctcgaacccgcggcgtcaggaaaac
ggccagatttgcgtggtggagagtcctgcggatatctacgccattgagcagaccgggcaa
ttttccgggcggtatttcgtgctgatgggccacctgtcgccgctggacggcatcgggccg
gatgatatcggtcttgatcgtctggaacagcggctggcgtcagaaaaaatcagtgagctg
atcctcgcgaccaacccgacggttgaaggggaggctaccgcgaactatattgccgagctg
tgcgcggaggccggcgtcgaagccagtcgtatcgcccacggcgtgccggttggcggcgaa
ctggagatggtcgacggtacgacgctgtcccactcgctggcgggacgccataagattatt
ttctga

DBGET integrated database retrieval system