KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C05700Help
Entry
STMDT12_C05700    CDS       T01742                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    STMDT12_C05700
Enzymes [BR:sem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     STMDT12_C05700
   3.1.2  Thioester hydrolases
    3.1.2.-  
     STMDT12_C05700
Lipid biosynthesis proteins [BR:sem01004]
 Fatty acid synthase
  Component type
   STMDT12_C05700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
complement(603901..604515)
Genome map
AA seq 204 aa AA seqDB search
MNFNTVFRWHLPFLFLILLTFRAAAADTLLILGDSLSAGYRMAASAAWPSLLNDKWQNKT
SVVNASISGDTSQQGLARLPALLQQHHPRWVVVELGGNDGLRGFAPAQTEQTLRKIIQTV
KAADAQPLLMQIHLPANYGRRYNESFSAIYPKLAKEFDIPLLPFFMEEVYLKPQWMQDDG
IHPNRDAQPFIADWMAKQLTPFLS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaacactgttttccgctggcatttgcccttcctgtttttgatcctgttaact
ttccgtgccgccgccgcagacaccttattaattctgggcgatagcctcagcgccggttac
cgtatggccgccagcgcggcatggccgtcgctccttaatgataaatggcaaaacaaaacg
tcggtcgttaatgccagtataagcggagatacctcgcagcagggactggcgcgtttgccg
gcgctgttgcaacagcatcacccgcgctgggtagtggtggaacttggcggcaacgatggc
ctacgcggttttgcgcctgcgcaaaccgaacagacgctacgtaaaatcattcagacggtg
aaagccgccgatgcccaaccgttactgatgcaaattcatctgcccgctaactacggtcgc
cgttataatgaatcctttagcgccatttatcctaagctcgccaaagagttcgatattcct
ctgttaccgttttttatggaagaggtatatctgaaaccgcagtggatgcaggatgacggc
attcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttgacc
ccttttctctcctga

DBGET integrated database retrieval system