KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C08250Help
Entry
STMDT12_C08250    CDS       T01742                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00010  Glycolysis / Gluconeogenesis
sem00260  Glycine, serine and threonine metabolism
sem00680  Methane metabolism
sem01100  Metabolic pathways
sem01110  Biosynthesis of secondary metabolites
sem01120  Microbial metabolism in diverse environments
sem01130  Biosynthesis of antibiotics
sem01200  Carbon metabolism
sem01230  Biosynthesis of amino acids
Module
sem_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sem_M00002  Glycolysis, core module involving three-carbon compounds
sem_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STMDT12_C08250 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    STMDT12_C08250 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STMDT12_C08250 (gpmA)
Enzymes [BR:sem01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     STMDT12_C08250 (gpmA)
Membrane trafficking [BR:sem04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    STMDT12_C08250 (gpmA)
Exosome [BR:sem04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   STMDT12_C08250 (gpmA)
  Exosomal proteins of melanoma cells
   STMDT12_C08250 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAJ35768
NITE: STMDT12_C08250
Position
complement(875191..875943)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaaacagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagatccttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgctcaaacattactatctgggcaacgctgacgaaatcgccgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system