KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C12280Help
Entry
STMDT12_C12280    CDS       T01742                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STMDT12_C12280
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    STMDT12_C12280
Enzymes [BR:sem01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     STMDT12_C12280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
1290306..1291319
Genome map
AA seq 337 aa AA seqDB search
MLNVEGCELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVRQIRAASRNHLVVAVDQE
GGRVQRFREGFTRLPAAQSFFALHGLEEGGRLAQEAGWLMASEMIAMDIDISFAPVLDVG
HISAAIGERSYHADPAKALAMATRFIDGMHDAGMKTTGKHFPGHGAVTADSHKETPCDPR
PETDIRGKDMSVFRTLISENKLDAIMPAHVIYRAIDPRPASGSPYWLKTVLRQELGFDGV
IFSDDLSMEGAAIMGSYAERAQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERVTRLY
HKGSFSRRELMDSARWKTASAQLNQLHERWQEEKAGH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatgtcgaaggatgtgagctggatgcggaggagcgcgagatactggcgcatccg
ctggttggcgggcttattctgttcacgcgtaattaccatgacccggaacagttgcgcgaa
ttagtgcgccagattcgggcggcatcgcgtaaccatctggtggtggccgtcgatcaggaa
ggcgggcgcgtacagcgtttccgtgaagggtttacccgcctgcccgcggcgcaatctttt
tttgcgctgcatgggctggaagagggggggcgactggcgcaggaggcagggtggctgatg
gccagcgaaatgatcgcgatggatattgatatcagttttgcgccagtgctggatgtcggg
catatcagcgcggcaattggcgagcgttcttatcatgccgatccagcaaaagcgttggca
atggcaacgcgctttattgacggcatgcatgacgccgggatgaaaacgaccggtaagcat
ttccccggccacggcgcggtcacggcggactcccacaaagagacgccgtgcgatccacgt
cctgaaacggacatccgtggcaaagatatgtcggtgttccgcacgctgattagcgagaat
aaactggatgcgattatgcctgcccacgtgatctaccgcgctatcgatccgcgtccggca
agcggttcgccgtactggctgaaaacggtgctgcgtcaggagttaggctttgatggcgtc
attttctccgacgatctgtcgatggagggcgcggcgattatgggcagctatgctgagcgc
gctcaggcgtcgctggatgcgggttgcgatatgattctggtctgcaataatcgtaaaggc
gcagtcagcgtgctggataatctgtcgccgatcaaagcagaacgtgttacacgtttgtat
cataaaggttcattttcacgccgggagctcatggactcagcacgctggaaaacagccagc
gcccagctcaaccagttacatgaacgctggcaggaagaaaaagcaggtcattaa

DBGET integrated database retrieval system