KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C13430Help
Entry
STMDT12_C13430    CDS       T01742                                 

Definition
(GenBank) 6-phosphofructokinase 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00010  Glycolysis / Gluconeogenesis
sem00030  Pentose phosphate pathway
sem00051  Fructose and mannose metabolism
sem00052  Galactose metabolism
sem00680  Methane metabolism
sem01100  Metabolic pathways
sem01110  Biosynthesis of secondary metabolites
sem01120  Microbial metabolism in diverse environments
sem01130  Biosynthesis of antibiotics
sem01200  Carbon metabolism
sem01230  Biosynthesis of amino acids
Module
sem_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sem_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STMDT12_C13430
   00030 Pentose phosphate pathway
    STMDT12_C13430
   00051 Fructose and mannose metabolism
    STMDT12_C13430
   00052 Galactose metabolism
    STMDT12_C13430
  Energy metabolism
   00680 Methane metabolism
    STMDT12_C13430
Enzymes [BR:sem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     STMDT12_C13430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: BAJ36286
NITE: STMDT12_C13430
Position
complement(1402777..1403709)
Genome map
AA seq 310 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIAHLGGTATAIFP
AGGATGEHLVALLADENVPVSTVDAKDWTRQNLHVHVESSGEQYRFVMPGATLDDDEFRQ
LEEQVLEIESGAILVISGSLPPGVKVEKLTQLISAAQKQGIRCIIDSSGDALTAALALGD
IELVKPNLKELSALVNRDLTQPDDVRKAAQELVQSGKARRVVVSLGPQGALGIDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAQDASLEEMVRFGVAAGSAATLNQGTRLCSRDDT
QKIYAYLSAQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacgcttgcgccctctctcgatagcgcaacaatcacgccg
caaatttatcccgaaggtaaactgcggtgctccgcgccggtattcgaacccggcggcggg
ggtattaatgtcgctcgcgccattgcgcatcttggcggcaccgcgaccgccattttcccg
gctggcggcgctaccggcgaacatcttgtcgcactactggctgacgaaaatgtccccgtg
tctaccgtcgatgcgaaggactggacgcgtcagaacctgcacgtccacgtcgagtccagc
ggcgaacagtatcgttttgttatgcccggcgccacgctggacgatgacgaatttcgccag
cttgaagaacaggtactggaaattgaatccggggcaattctggttatcagcggcagcctt
ccgcccggcgttaaggtcgagaaactcacgcaactgatttccgccgcgcagaagcaaggc
attcgctgcattattgatagctctggcgacgcgctcaccgccgcgctggcgcttggcgat
atcgaactggtgaaaccgaacctgaaagaattgagcgcgttggttaatcgtgatctgacg
cagcctgatgatgtgcgtaaagcggcccaggaattagtgcaaagcggcaaggctcgccgg
gtagtggtctctctggggccgcaaggggcgctgggcatagacagtgagaattgcatccag
gttgttcctcccccggtgaaaagtcaaagtactgttggcgcaggcgacagtatggtaggc
gcgatgacgttaaaactggcgcaagacgcgtcgctggaagagatggtgcgcttcggtgtg
gcggcaggcagcgctgctacgctcaatcaaggtacgcgtctgtgttctcgtgacgatacc
caaaaaatatacgcctatctttccgcgcaataa

DBGET integrated database retrieval system