KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C15410Help
Entry
STMDT12_C15410    CDS       T01742                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sem00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sem00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:sem00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
1600346..1601260
Genome map
AA seq 304 aa AA seqDB search
MDNAILETILQRVRPLIGQGKVADYIPALASVEGSKLGIAICTVDGQHYQAGDAHERFSI
QSISKVLSLVVAMRHYPEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGALVVC
DMLQGRLSAPRQRMLEVVRALCGVSDITYDATVARSEFEHSARNAAIAWLMKSFGNFHHD
VPTVLQNYFHYCALKMSCMELARTFVFLANQGEAFHLDEPVVTPMQARQINALMATSGMY
QNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAALEQLTQTLG
RSVY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggataatgcaattttagagacgattttacagcgcgttcgccccctcattggccagggc
aaagtcgctgactatattccggcattagcgtccgtcgaaggttcaaagctggggatagcg
atttgtaccgtggacgggcagcattatcaggcgggcgatgcgcacgaacgcttctctatt
cagtctatttcgaaagtgctcagtctggtggtggcgatgcgtcattatccggaagaggag
atctggcagcgcgtcggaaaagatccttccggctcgccgttcaattcgttggttcagtta
gagatggaacaaggcatcccgcgtaatccatttattaatgcgggcgcgctggtggtatgc
gacatgttgcaaggccggcttagcgcgccgcgtcagcggatgctggaagttgtgcgcgcg
ctttgcggcgtatcggatattacgtatgacgctacggtcgcgcgctctgaatttgagcat
tccgcccgtaacgccgctattgcctggctgatgaaatcattcggtaattttcatcatgat
gtgcctaccgtgttgcaaaattactttcactactgtgcgttgaaaatgagctgcatggaa
ctggcgaggacgtttgtctttctggcgaatcagggcgaggcgtttcatctcgacgagccg
gtagtgacccccatgcaggcccggcagattaatgcgctaatggcgaccagcgggatgtat
cagaatgccggcgagtttgcctggcgggtgggattgcccgctaaatccggcgtgggcggc
ggtattgtcgccatagtgccgcatgaaatggcgattgccgtctggagtccggagctggat
cctgcgggaaactctctggcaggtatcgccgcgcttgagcaattaacacaaacgttagga
cgttcggtatactga

DBGET integrated database retrieval system