KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C15410Help
Entry
STMDT12_C15410    CDS       T01742                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STMDT12_C15410
   00330 Arginine and proline metabolism
    STMDT12_C15410
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    STMDT12_C15410
Enzymes [BR:sem01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     STMDT12_C15410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
1600346..1601260
Genome map
AA seq 304 aa AA seqDB search
MDNAILETILQRVRPLIGQGKVADYIPALASVEGSKLGIAICTVDGQHYQAGDAHERFSI
QSISKVLSLVVAMRHYPEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGALVVC
DMLQGRLSAPRQRMLEVVRALCGVSDITYDATVARSEFEHSARNAAIAWLMKSFGNFHHD
VPTVLQNYFHYCALKMSCMELARTFVFLANQGEAFHLDEPVVTPMQARQINALMATSGMY
QNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAALEQLTQTLG
RSVY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggataatgcaattttagagacgattttacagcgcgttcgccccctcattggccagggc
aaagtcgctgactatattccggcattagcgtccgtcgaaggttcaaagctggggatagcg
atttgtaccgtggacgggcagcattatcaggcgggcgatgcgcacgaacgcttctctatt
cagtctatttcgaaagtgctcagtctggtggtggcgatgcgtcattatccggaagaggag
atctggcagcgcgtcggaaaagatccttccggctcgccgttcaattcgttggttcagtta
gagatggaacaaggcatcccgcgtaatccatttattaatgcgggcgcgctggtggtatgc
gacatgttgcaaggccggcttagcgcgccgcgtcagcggatgctggaagttgtgcgcgcg
ctttgcggcgtatcggatattacgtatgacgctacggtcgcgcgctctgaatttgagcat
tccgcccgtaacgccgctattgcctggctgatgaaatcattcggtaattttcatcatgat
gtgcctaccgtgttgcaaaattactttcactactgtgcgttgaaaatgagctgcatggaa
ctggcgaggacgtttgtctttctggcgaatcagggcgaggcgtttcatctcgacgagccg
gtagtgacccccatgcaggcccggcagattaatgcgctaatggcgaccagcgggatgtat
cagaatgccggcgagtttgcctggcgggtgggattgcccgctaaatccggcgtgggcggc
ggtattgtcgccatagtgccgcatgaaatggcgattgccgtctggagtccggagctggat
cctgcgggaaactctctggcaggtatcgccgcgcttgagcaattaacacaaacgttagga
cgttcggtatactga

DBGET integrated database retrieval system