KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C15860Help
Entry
STMDT12_C15860    CDS       T01742                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    STMDT12_C15860
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STMDT12_C15860
  Lipid metabolism
   00071 Fatty acid degradation
    STMDT12_C15860
  Amino acid metabolism
   00350 Tyrosine metabolism
    STMDT12_C15860
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STMDT12_C15860
   00626 Naphthalene degradation
    STMDT12_C15860
Enzymes [BR:sem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STMDT12_C15860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
1645484..1646494
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHQVDVTEKTLRPLRHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNTGNETLCRNVKNAGYTVDGGMAEE
CIVVADYAVKVPEGLDSAAASSITCAGVTTYKAVKISHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLKLAEEMGADLTINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMNLDIPRLVLDGIQVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLEDINVIFKEMEQGQIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttgtcacacaagatcatcaggttgatgttactgagaaaacgctgcgt
ccccttcgccacggtgaagctttgctaaaaatggagtgctgcggcgtatgccataccgat
ctacacgtgaaaaacggcgatttcggtgacaaaaccggcgttattctgggacacgaaggc
attggcgtcgtggcggaagtcggtcctggtgtcacctcgctgaaacccggcgatcgcgcg
agtgtcgcgtggttttatgaaggatgcggacactgtgagtattgcaatacgggcaatgaa
accttatgccgcaacgtgaaaaatgccggttacacggtagatggcggtatggccgaagag
tgtattgtcgtcgcggattatgcggtgaaagtaccggaaggtctggactctgcagcggca
agtagtattacctgcgcgggcgttaccacctataaagcggtgaagatttctcatattaaa
cctggccagtggattgccatctacggtctgggcggtctgggtaatctggccttgcagtac
gcgaaaaacgttttcaatgcgaaagtgatcgccattgatgtcaatgatggacaactgaaa
ctggccgaggaaatgggcgcagatctgaccattaattcacgtacggaagatgcggctaaa
attgtgcaggaaaaaaccggtggcgcgcacgcagcggtggttaccgcggtcgctaaggcg
gcgtttaattccgcagtagatgccgttcgcgccggaggccgcgtggtggcagtcgggttg
ccgccagaagccatgaaccttgatatccctcgcctggtgctggatggcattcaggttgtc
ggttcgttggtggggacacgccaggatctgaccgaagccttccagtttgcggcggaagga
aaagtcgtgccaaaagtcgctttacgtccgcttgaagatatcaacgttatttttaaagag
atggaacagggacaaattcgtggccgtatggtcatcgatttccgtcgttaa

DBGET integrated database retrieval system