KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C17490Help
Entry
STMDT12_C17490    CDS       T01742                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sem01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sem00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sem00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Structure
PDB: 

Jmol
Position
1820770..1821963
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQKDPEFQAQFADLLKNYAGRPTALT
KCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGM
FADFINDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSI
SAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALK
MMREQPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacttctcaacccctactttggtgaattcggcggcatgtatgtgccgcagatc
ctgatgcctgcgctgaaccagcttgaagaggccttcgtcagcgcgcaaaaagatcctgaa
tttcaggcgcaattcgccgatctgctaaaaaactacgcgggacgccccaccgcgctgacg
aaatgccagaacattaccgccggtacgcgtaccacgttgtatttaaagcgcgaagattta
ctgcacggcggcgcgcacaaaaccaatcaggtactgggtcaggcgctgctggccaaacgg
atgggtaaaagcgagattatcgctgaaaccggcgccggtcagcacggcgtcgcctctgcg
ctcgccagcgccctgctgggtctgaaatgccgtatctatatgggcgccaaagacgttgag
cgccagtcgccgaacgtcttccgtatgcgtctgatgggcgctgaggtcatcccggttcat
agcggctccgctacgctaaaagatgcctgtaacgaggcgctgcgcgactggtccggtagt
tacgaaaccgcgcactatatgctcggcacggcggcaggaccgcatccctatcccaccatc
gttcgcgagttccagcgcatgattggcgaagagacgaaagcgcaaatcctcgacaaagag
ggccgtctgccagatgccgttatcgcttgcgtcggtggcggctcaaacgctatcgggatg
tttgccgattttattaatgataccagcgtcgggctaataggcgttgaacctggtggtcat
ggtattgaaaccggcgagcatggcgcgccgcttaaacatggtcgcgttggcatctatttc
gggatgaaagcgccgatgatgcaaacagcagacgggcaaattgaagagtcctattccatt
tccgccgggctcgatttcccgtccgttgggccgcaacatgcgtacctgaacagcatcgga
cgcgcggattatgtctccattaccgatgatgaggcgctggaagccttcaaaacgttgtgc
cgccatgagggaattatcccggcgctggagtcctcccacgcgttggcgcacgctctgaaa
atgatgcgcgagcagccggaaaaagagcaactgctggtggtcaatctctctggccgcgga
gataaagacatctttaccgtacacgatatcctgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system