KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C17500Help
Entry
STMDT12_C17500    CDS       T01742                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STMDT12_C17500 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STMDT12_C17500 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STMDT12_C17500 (trpA)
Enzymes [BR:sem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STMDT12_C17500 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Structure
PDB: 

Jmol
Position
1821963..1822769
Genome map
AA seq 268 aa AA seqDB search
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLAD
GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQ
VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRS
GVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKI
IEKNLASPKQMLAELRSFVSAMKAASRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaaaatttatttgcccaactcaacgatcgccgggaaggcgcttttgtc
cccttcgtgaccctgggcgaccctggcattgaacagtcactgaaaattattgacacactg
attgacgctggcgccgacgctctggaactgggggttcccttctccgatccgctggccgat
ggccctaccatccagaatgcgaacttacgcgccttcgccgctggcgtcacgccggctcag
tgttttgaaatgctggcgctgattcgtgaaaaacacccgaccattccgattggcctgcta
atgtacgcgaatctggtgttcaataacggcatagatgcgttctatgcccgttgtgaacag
gttggcgtagattccgtgctggtcgcagatgtcccggttgaagaatcggcccccttccgc
caggcagcgttacggcataatatcgcgccgatcttcatctgcccgccaaatgcggatgac
gatcttctgcgccaggtcgcatcttacggccgcggttacacctacctgctttcgcgttcg
ggtgtcaccggcgcggaaaaccgtggcgcattgccgttgcatcatctcattgagaagctt
aaagagtaccatgccgcgcctgcgttacagggcttcggtatctcctcgccggaacaggtg
tctgcggccgtgcgtgccggggcggctggcgctatctccggctcagccattgtcaagatt
atcgagaaaaacctcgcgtctcccaaacagatgttggcggagctcaggtcctttgtctca
gccatgaaagccgccagccgcgcataa

DBGET integrated database retrieval system