KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C17710Help
Entry
STMDT12_C17710    CDS       T01742                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00010  Glycolysis / Gluconeogenesis
sem00071  Fatty acid degradation
sem00350  Tyrosine metabolism
sem00620  Pyruvate metabolism
sem00625  Chloroalkane and chloroalkene degradation
sem00626  Naphthalene degradation
sem00650  Butanoate metabolism
sem01100  Metabolic pathways
sem01110  Biosynthesis of secondary metabolites
sem01120  Microbial metabolism in diverse environments
sem01130  Biosynthesis of antibiotics
sem01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STMDT12_C17710
   00620 Pyruvate metabolism
    STMDT12_C17710
   00650 Butanoate metabolism
    STMDT12_C17710
  Lipid metabolism
   00071 Fatty acid degradation
    STMDT12_C17710
  Amino acid metabolism
   00350 Tyrosine metabolism
    STMDT12_C17710
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STMDT12_C17710
   00626 Naphthalene degradation
    STMDT12_C17710
Enzymes [BR:sem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STMDT12_C17710
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     STMDT12_C17710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: BAJ36714
NITE: STMDT12_C17710
Position
1840819..1843497
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKEATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYMLQGQELKAVQNVILKNGALNAAIVGQP
AYKIAELAGFSVPETTKILIGEVTVVDESEPFAHEKLSPTLAMYRAKDFEEAVEKAEKLV
AMGGIGHTSCLYTDQDNQPERVAYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSVVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRDFTEGEVAAKKDVVAAPKAEKKAKKSA
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagagcgtgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagaacaggtcgacaaaatcttccgcgccgccgctctg
gctgccgctgatgcccgcattccgctggccaaaatggccgtcgccgaatccggtatgggt
atcgtggaagacaaagtgattaaaaaccacttcgcttctgaatatatttacaacgcctat
aaagatgaaaaaacctgcggcgtgctgtctgaagacgacaccttcgggaccatcaccatt
gctgaacctatcggcattatttgcggtatcgttccaaccactaacccaacctctaccgcg
atcttcaaatcgctgattagcctgaagacccgtaacgccatcatcttttctccgcatccg
cgcgctaaagaagcaaccaacaaagcggcagacatcgttctgcaagcggctatcgctgcc
ggcgcgccgaaagatctgattggctggatcgatcaaccttccgtagaactgtctaacgcg
ttgatgcaccacccggatattaacctgatcctcgccactggcggtccaggcatggttaaa
gctgcatacagctccggtaaaccggctatcggcgtaggcgcaggcaacactccggttgtc
attgatgaaaccgctgatatcaaacgcgctgtggcgtctgttctgatgtctaaaaccttc
gataacggcgtaatctgtgcttctgaacagtctgttgtcgttgttgattccgtctatgat
gccgttcgcgaacgtttcgccagccatggcggctacatgctgcagggccaggagctgaaa
gcggttcaaaacgttatcctgaaaaatggcgctctgaacgccgctatcgtcggccagcca
gcctacaaaatcgctgaactggcaggcttctccgtaccagaaaccaccaagattctgatc
ggtgaagttacggtcgttgacgaaagcgaaccgttcgcacacgaaaaactgtctccgact
ctggcgatgtatcgtgcgaaagatttcgaagaagcggtagaaaaagcagaaaaactggtc
gctatgggcggtatcggtcacacctcctgcctgtacactgaccaggataaccagccagaa
cgcgttgcttacttcggtcagatgatgaaaaccgcgcgtatcctgatcaacaccccggcc
tctcagggtggtatcggtgacctgtacaacttcaaactcgcaccttccctgacgttgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgccgtggctctctgcccatcgcgctggatgaagtgattactgatggccacaaa
cgtgcgctcatcgtgactgaccgcttcctgttcaacaacggctatgcagaccagatcacc
tctgtgctgaaagcggctggcgttgaaaccgaagtcttcttcgaagttgaagcagacccg
acgctttccgttgttcgcaaaggcgctgagctggctaactccttcaaaccggacgtgatc
atcgcgctgggcggcggttccccgatggacgccgcgaaaatcatgtgggtcatgtacgaa
catccggaaactcacttcgaagaactggcgctgcgctttatggacatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgccgtcaccaccacttccggt
accggttctgaagtcacaccgtttgcggttgtgaccgacgatgcaaccggtcagaaatat
ccgctggctgactacgccctgaccccggatatggcgattgtcgacgccaacctggtgatg
gatatgccgaagtccctgtgtgcgttcggtggtctggatgcggtaactcacgctctggaa
gcttatgtttccgtactggcttctgagttctctgacggtcaggctctgcaggctctgaaa
ctgctgaaagaaaacctgccggcgtcttaccacgaaggttccaagaacccggttgcgcgt
gaacgtgttcacagcgccgcgactatcgccggtatcgcgtttgccaacgccttcctcggt
gtatgtcactccatggcgcacaaactgggctctcagttccacattccgcacggtctggcg
aacgccctgctgatttgtaacgttatccgctacaacgcgaatgacaacccgaccaagcag
accgctttcagccagtacgatcgtccgcaggcacgccgtcgttacgctgaaattgctgac
cacctgggcctgagcgcgccgggcgaccgtaccgctgctaagattgaaaaactgctggca
tggctggaaagcattaaagctgagctgggtattcctaagtctatccgtgaagcaggcgta
caggaagctgacttcctggcacacgttgacaaactgtctgaagatgccttcgatgaccag
tgcaccggcgctaacccgcgttatccactgatctccgaactgaaacagattctgctggat
acctactacggtcgtgatttcaccgaaggtgaagttgcagcgaagaaagacgtcgttgcc
gcaccgaaagcagagaaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system