KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C18000Help
Entry
STMDT12_C18000    CDS       T01742                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STMDT12_C18000 (ipk)
Enzymes [BR:sem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     STMDT12_C18000 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
1873986..1874837
Genome map
AA seq 283 aa AA seqDB search
MMTHWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLHIEPRHDGEIHLLTPVNGV
ENEDNLIVRAARLLMKVASESGRLPAGSGADISIEKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSIDELATLGLTLGADVPVFVRGHAAFAEGVGEILTPVNPPEKWYLVAHPGVSIP
TPVIFKDPQLPRNTPKRSIDTLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGT
GACVFAEFDTESCARQVLEQAPEWLNAFVAKGVNLSPLHRELL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccattggccttctccggcaaaattaaatctgtttttatatatcaccggacag
cgagcagacggctaccacacgctgcagacgctgtttcagtttctggattatggcgacaca
ctccacatcgaaccgcgtcacgatggcgaaatccatttattaacgccggttaacggcgtt
gaaaatgaagacaatctgatcgtccgtgccgcgcggctgttgatgaaagtcgcctcggag
agtgggcgcctgcccgccggaagcggtgcggatatcagcattgagaagcgccttcccatg
ggcggcggtctgggcggcggctcatctaacgccgcgaccgttctggtggcgctcaatcat
ctttggcaatgcgggctttccattgatgaactggcgacgctcggcctgacgctcggcgcc
gacgtcccggtctttgttcgtggccacgccgcgtttgccgaaggcgtaggcgaaatatta
acgccggtgaatccgccggaaaaatggtatctggtcgcgcaccctggcgtaagcattccc
acaccggttatctttaaagatcctcaattgccgcgtaatacgccaaaaaggtcaatagat
acgttactaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgcggcgctttcctggctgttagaatacgcgccgtcgcgcctgactgggaca
ggggcctgtgtctttgctgaattcgatacagagtcttgtgctcgccaggtgcttgagcaa
gccccggaatggctcaatgcttttgtggcgaagggtgtcaacctctccccattgcatcga
gagttactctaa

DBGET integrated database retrieval system