KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C19740Help
Entry
STMDT12_C19740    CDS       T01742                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:sem00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Structure
PDB: 

Jmol
Position
complement(2037591..2038577)
Genome map
AA seq 328 aa AA seqDB search
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNKLRKLEFLVA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLD
LFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQC
EEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAG
QLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGIS
QKRFNDDGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactacatcacttaacgcgcttccctcgcctggagtttatcggcgcgccgaccccg
ctcgaatacctgccgcgattgtctgattatcttggccgtgagatttacattaagcgcgat
gacgttacgcccattgcaatgggcggcaataaactgcgcaagctggagtttttggtggcc
gacgcgctgcgagaaggggcggatacgctgataaccgcaggggcgattcagtcgaaccat
gtccgtcagacggcggcagtcgcggccaaattgggactgcattgcgtcgccttgctggaa
aatccaatcggtaccaccgcggaaaattacctgacgaatggtaatcgcctgttactggat
ttatttaatacgcaaattgagatgtgcgatgcgctaaccgatccggatgcgcagctgcaa
acgctggcgacgcgcattgaagcgcaagggttcaggccctatgtgattccggtcggcggt
tccagcgcgctgggggcaatgggatacgtagagagcgccctggaaatcgcccagcagtgt
gaagaggtcgtcgggctctcttcggtggtggtggcctccggcagcgccggaacgcacgcc
gggttagctgtcgggctggaacatctgatgccggatgtcgaactgattggcgtgaccgtt
tcacgttctgtcgccgagcagaaacccaaagtgattgccttgcagcaggctattgccggt
cagctggcgctgacggcgacggcggatatccatttatgggatgactattttgccccgggt
tacggcgtgccaaatgacgcggggatggaggcggtgaaactgctggcgagcctggagggg
gtgctgctggatccggtatataccggtaaagcgatggcgggtctgatagacggcatcagc
cagaaacgctttaacgatgacgggccgattctctttattcacaccggtggggcgcctgcg
ctgtttgcctaccatcctcatgtataa

DBGET integrated database retrieval system