KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C20940Help
Entry
STMDT12_C20940    CDS       T01742                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sem01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sem00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
2146158..2147462
Genome map
AA seq 434 aa AA seqDB search
MSFNTLIDWNSCSPEQQRALLTRPAISASDSITRTVSDILDNVKTRGDDALREYSAKFDK
TEVTALRVTPEEIAAAGARLSDELKQAMTAAVKNIETFHSAQTLPPVDVETQPGVRCQQV
TRPVSSVGLYIPGGSAPLFSTVLMLATPARIAGCQKVVLCSPPPIADEILYAAQLCGVQE
IFNVGGAQAIAALAFGSESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADIARKVAEAVERQLAELPRADTARQ
ALSASRLIVTKDLAQCVAISNQYGPEHLIIQTRNARDLVDAITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKAGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaataccctgattgactggaacagctgtagccctgaacagcagcgtgcgctg
ctgacgcgtccggcgatttccgcctctgacagtattacccggacggtcagcgatattctg
gataatgtaaaaacgcgcggtgacgatgccctgcgtgaatacagcgctaaatttgataaa
acagaagtgacagcgctacgcgtcacccctgaagagatcgccgccgccggcgcgcgtctg
agcgacgaattaaaacaggcgatgaccgctgccgtcaaaaatattgaaacgttccattcc
gcgcagacgctaccgcctgtagatgtggaaacccagccaggcgtgcgttgccagcaggtt
acgcgtcccgtctcgtctgtcggtctgtatattcccggcggctcggctccgctcttctca
acggtgctgatgctggcgacgccggcgcgcattgcgggatgccagaaggtggttctgtgc
tcgccgccgcccatcgctgatgaaatcctctatgcggcgcaactgtgtggcgtgcaggaa
atctttaacgtcggcggcgcgcaggcgattgccgctctggccttcggcagcgagtccgta
ccgaaagtggataaaatttttggccccggcaacgcctttgtaaccgaagccaaacgtcag
gtcagccagcgtctcgacggcgcggctatcgatatgccagccgggccgtctgaagtactg
gtgatcgcagacagcggcgcaacaccggatttcgtcgcttctgacctgctctcccaggct
gagcacggcccggattcccaggtgatcctgctgacgcctgatgctgacattgcccgcaag
gtggcggaggcggtagaacgtcaactggcggaactgccgcgcgcggacaccgcccggcag
gccctgagcgccagtcgtctgattgtgaccaaagatttagcgcagtgcgtcgccatctct
aatcagtatgggccggaacacttaatcatccagacgcgcaatgcgcgcgatttggtggat
gcgattaccagcgcaggctcggtatttctcggcgactggtcgccggaatccgccggtgat
tacgcttccggaaccaaccatgttttaccgacctatggctatactgctacctgttccagc
cttgggttagcggatttccagaaacggatgaccgttcaggaactgtcgaaagcgggcttt
tccgctctggcatcaaccattgaaacattggcggcggcagaacgtctgaccgcccataaa
aatgccgtgaccctgcgcgtaaacgccctcaaggagcaagcatga

DBGET integrated database retrieval system