KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C33500Help
Entry
STMDT12_C33500    CDS       T01742                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sem00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
complement(3487001..3487849)
Genome map
AA seq 282 aa AA seqDB search
MKLFAQGATLDLTHPHVMGILNVTPDSFSDGGAHNTLIEAVKHANLMVNAGATIIDVGGE
STRPGAAEVSVEEELDRVIPVLEAIAQRFEVWISVDTSKPEVIREAARAGAHIINDVRSL
SEPGALEAAAETGLPVSLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEKAGIAKE
KLLLDPGFGFGKNLSHNYTLLARLGEFHHFNLPLLVGMSRKTMVGQLLNVGPSDRLNGSL
ACAVIAAMQGAQIIRVHDVKETVEAMRVVEATLSAKGNKRYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttcgctcagggcgccacgctcgatctcactcatccgcatgttatggggatc
ctgaacgtaacgccggattcgttctccgacggcggcgcgcataacacgctgattgaggcg
gtgaaacatgcgaatttaatggtgaatgccggggcgacaattattgatgtggggggggaa
tcaacgcgaccaggcgcggcagaagtgagcgtggaagaagagctggatcgcgttattccg
gtactggaagcaatcgcgcaacgttttgaagtgtggatttctgtggatacctctaaaccc
gaggtgatccgtgaagcggcaagggcgggcgcgcatattatcaatgatgtccgttcactc
tccgaacccggcgcgttggaagcggcagcggaaaccggcttgccggtcagtcttatgcac
atgcagggcaaccccaaaaccatgcaggaggcgccgaaatatgacgatgtctttgccgag
gtgaatcgctactttattgagcaaatagcacgttgtgagaaggccggcatcgcaaaagag
aaattgttgctcgacccaggattcggtttcggtaaaaatctctctcacaattatacctta
ctggcgcgactgggtgagtttcatcattttaacctgccgctgctggtgggcatgtcacgt
aaaacgatggttggtcagttacttaacgtgggaccatcagaccgtctgaacggcagcctt
gcgtgcgcggtaattgccgcgatgcagggcgcgcagatcattcgcgtccatgacgtcaaa
gaaaccgtagaggcgatgcgggtggtggaagccactctgtctgcaaagggaaacaaacgc
tatgagtaa

DBGET integrated database retrieval system