KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C36720Help
Entry
STMDT12_C36720    CDS       T01742                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STMDT12_C36720
Enzymes [BR:sem01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     STMDT12_C36720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
complement(3820314..3821423)
Genome map
AA seq 369 aa AA seqDB search
MMTMLRGWITMLVMLTAINAQAACSWPAWEQFKKDYISQQGRVIDPGDARKITTSEGQSY
AMFFALAANDRPAFAQLFNWTQNNLAQGSLREYLPAWLWGQKDPDTWSVLDSNSASDGDI
WMAWSLLEAGRLWKETRYTEVGTALLKRIAREEVLNVPGLGSMLLPGKIGFAEANSWRFN
PSYLPPQLAQYFSRFGAPWSTLRETNLRLLLETAPKGFSPDWVRYESKQGWQLKAEKTLI
SSYDAIRVYLWAGMMHDGDPQKARLLARFKPMATLTMKNGVPPEKVDVVSGNAQGTGPVG
FSAALLPFLQNRDAQAVQRQRVADHFPGSDAYYNYVLTLFGQGWDQHRFRFTVKGELLPD
WGQECVSSR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgactatgctgcgcggatggataacgatgctcgtcatgctgacggcaataaatgcg
caggcagcctgtagctggcctgcgtgggaacagttcaagaaagattacattagccagcag
ggacgcgttatcgatccgggcgatgcgcgaaaaattaccacctccgaagggcaaagctac
gccatgttctttgccctggcagcgaacgatcgaccggcgttcgcgcaactgtttaactgg
acgcaaaacaatctggcgcagggatcgttgcgtgaatatctgcccgcctggctgtggggg
caaaaagatcccgacacctggtcggtgctggacagcaactccgcgtccgacggcgatatc
tggatggcatggtcgctgctggaggccggtcgtctgtggaaagagacgcgttataccgag
gtgggcacggcgttgctaaaacgcatcgcccgcgaagaggtcctgaatgtgccggggctg
ggctcaatgctgctacctggcaaaatcggctttgccgaggcgaatagctggcgttttaac
ccaagctatctgccgccgcagttggcgcaatactttagccgttttggcgcgccgtggtcg
acgttacgggaaaccaatttgcggcttttgctggaaaccgcgccgaaaggtttctcgccg
gactgggtgcgttatgaaagcaagcaaggctggcagttgaaagcggaaaagacgctgatc
agtagctacgatgcgattcgcgtctatttatgggcgggaatgatgcatgatggcgatccg
caaaaagcgcgtttactggcgcgatttaaaccgatggcgacgttaacgatgaaaaacggc
gttccaccggagaaagtggatgtcgtcagcgggaatgcgcaagggacggggccggtcggg
ttttccgccgccttactgcctttcctgcaaaatcgcgacgcccaggccgtgcagcgacag
cgggtcgcagaccattttcctggcagcgatgcctattacaactatgtgctgactctcttt
ggacaaggctgggatcagcaccgttttcgcttcaccgtcaaaggtgaattattacctgac
tggggccaggaatgcgtaagttcacgttaa

DBGET integrated database retrieval system