KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C38010Help
Entry
STMDT12_C38010    CDS       T01742                                 

Definition
ATP-dependent DNA helicase RecG
Orthology
K03655  
ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sem03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
3959777..3961858
Genome map
AA seq 693 aa AA seqDB search
MSGRLLDAVPLNSLTGVGAAQSSKLAKIGLHTVQDLLLHLPLRYEDRTHLYPIGELLPGI
YATVEGEVLNCNITFGGRRMMTCQISDGSGILTMRFFNFNAAMKNSLATGRRVLAYGEAK
RGKYGAEMIHPEYRLQGDLSTPELQETLTPVYPTTEGVKQATLRKLTDQALELLDTCAIA
ELLPPELAQGMMSLPEALRTLHRPPPTLQLADLETGKHPAQRRLILEELLAHNLSMLALR
AGAQRYHAQPLSTNNILKDKLLASLPFKPTSAQARVVAEIERDMALDVPMMRLVQGDVGS
GKTLVAALAALRAIAHGKQVALMAPTELLAEQHANNFRNWFEPLGVEVGWLAGKQKGKAR
QAQQEAIASGQVQMIVGTHAIFQEQVQFNGLALVIIDEQHRFGVHQRLALWEKGQQQGFH
PHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPVTTVAIPDTRRHEIIDRVRNACT
TEGRQAYWVCTLIEESDLLEAQAAEATWEELKLALPELNIGLVHGRMKPAEKQAVMQAFK
QGELHLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGAVASHCVLLYKS
PLSKTAQKRLQVLRDSNDGFVIAQKDLEIRGPGELLGTRQTGNAEFKVADLLRDQAMIPE
VQRIARHIHERYPQQAQALIERWMPETERYSNA
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggccgcttgttagacgctgttccgctcaattccctgacaggcgtcggcgcagcg
caaagcagtaaactggcgaaaattggcctgcacaccgtgcaggacctcctgctccacctc
cctctgcgttacgaagaccgcacccatctctaccccattggcgaactgctgcctggcatc
tacgccaccgttgaaggcgaagtgctgaactgcaatatcactttcggcggtcgtcggatg
atgacctgccagattagcgacggttccggcattcttaccatgcgctttttcaattttaac
gcagcgatgaaaaacagcctggcgacgggacgacgtgtgctggcctacggggaagcgaag
cgcggcaagtatggcgcagagatgatccatccggaatatcgcctgcagggcgatctcagc
acgccggaacttcaggaaacgctcacccccgtctatccgaccaccgagggcgtgaagcaa
gcgacactgcgcaagcttaccgatcaggcgctggagttgctcgacacctgcgccattgcc
gaactactgccgccggaactggcgcagggtatgatgagcctgccggaggcgctacgtacc
ttgcatcgcccgccgccgacgctccagctcgccgatttagaaaccggcaaacacccggcg
cagcggcggcttattcttgaagagctactggcgcataatctcagtatgctggcgcttcgc
gcaggcgcgcagcgctaccacgctcagccgctaagtaccaacaacatattgaaagacaag
ctgctggcgtcgttgccgtttaaacccaccagcgcgcaggcgcgggtggtagcagagatc
gaacgtgatatggcgctggatgtgccgatgatgcgtctggttcagggcgacgtgggttcc
ggtaaaacgttggttgcggcgcttgccgccttgcgcgctattgcccacggtaagcaggtg
gcgctgatggcgccgaccgaattgctggctgaacagcacgcaaataatttccgcaactgg
ttcgaaccgttgggcgttgaagtgggttggctggccggtaagcaaaaaggtaaagcgcgt
caggcgcagcaagaggctattgccagcggtcaggtgcagatgattgtcggcacccacgct
atcttccaggaacaggtgcagtttaacgggctggcgctggttattatcgatgagcagcac
cgctttggcgtccaccagcggctggcattgtgggaaaaaggccagcagcagggctttcat
ccgcatcagttgattatgaccgcaacgcccattccgcgcaccctggcgatgactgcctac
gccgatctcgatacctcggtgattgacgagctaccgccgggccgtacccctgtcactacc
gttgcgattccggatacccgtcgccatgaaatcattgatcgtgtgcgcaacgcctgcaca
accgaaggccgtcaggcctactgggtctgtacgctgattgaagagtcagacctgctggaa
gcgcaggcagcggaagccacctgggaggagctcaagctggcgttaccggagttgaatatc
ggcctggtacacggccgcatgaagcccgccgaaaaacaggcggtgatgcaggcctttaag
cagggcgaactgcatctgctggtcgccactacggtgattgaggtgggggtcgatgttcct
aacgccagcctgatgattattgaaaacccggagcgactgggcctggcgcagttacaccag
ctcagagggcgcgttggccgtggcgcggtcgcatcgcactgcgtgctgctctataaatcg
ccgctgtcgaaaacggcgcagaagcgtttacaggtattgcgcgacagcaacgacggcttt
gtgattgcacaaaaagatttagagattcgcggcccgggggaattactgggcacgcgccag
acgggtaacgccgaatttaaagtagctgatttgctgcgcgatcaagccatgatccccgaa
gttcagcgtattgcccgtcatattcacgaacgttatccacagcaggcacaagcgctgatt
gagcgctggatgccggaaaccgaacgttattccaacgcctaa

DBGET integrated database retrieval system