KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C40870Help
Entry
STMDT12_C40870    CDS       T01742                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00860  Porphyrin and chlorophyll metabolism
sem01100  Metabolic pathways
sem01110  Biosynthesis of secondary metabolites
sem01120  Microbial metabolism in diverse environments
Module
sem_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    STMDT12_C40870 (hemD)
Enzymes [BR:sem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     STMDT12_C40870 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: BAJ39030
NITE: STMDT12_C40870
Position
complement(4249424..4250164)
Genome map
AA seq 246 aa AA seqDB search
MSILITRPSPAGEALVSRLRALGQVAWSFPLIEFVAGRELPTLADRLATLTENDLVFALS
QHAVAFAHAQLQRDGRNWPVAPRYFAIGRTTALALHTVSGFDIRYPLDREISEALLQLPE
LQNIAGKRALILRGNGGRELLGETLTARGAEVSFCECYQRCAKHYDGAEEAMRWHTRGVT
TLVVTSGEMLQRLWSLTPQWYREHWLLRCRLLVVSERLAHLARELGWQDIKVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtattctgatcacccgcccctctcccgcaggggaagcgttagtgagccgtctgcgc
gcactggggcaggtggcctggagttttccactgattgaatttgtcgccggtcgggagcta
cccaccctggccgaccgcctggcgacgctgacggaaaacgatctggtttttgccctttca
cagcacgctgtcgcctttgctcacgcccagctccagcgggatggtcgaaactggcctgtg
gcgccgcgctatttcgcgattggccgcaccacggcgctcgcccttcataccgttagcggg
ttcgatattcgttatccattggatcgggaaatcagcgaagccttgctacaattacctgaa
ttacaaaatattgcgggcaaacgcgcgctgattttgcgtggcaatggcggccgcgaactg
ctgggcgaaaccctgacagcgcgcggagccgaagtcagtttttgtgaatgttatcaacga
tgtgcgaaacattacgatggcgcggaagaagcgatgcgctggcatactcgcggcgtaaca
acgcttgttgttaccagcggcgagatgttgcaacggctctggtcgctgactccccagtgg
tatcgtgagcactggttactacgctgtcggctattggtcgtcagtgagcgtctggcgcac
ctcgcccgggaactgggctggcaagatattaaggtcgctgataacgccgacaacgatgcg
ctgttgcgcgcattacaataa

DBGET integrated database retrieval system