KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C42090Help
Entry
STMDT12_C42090    CDS       T01742                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STMDT12_C42090
   01230 Biosynthesis of amino acids
    STMDT12_C42090
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STMDT12_C42090
   00030 Pentose phosphate pathway
    STMDT12_C42090
   00051 Fructose and mannose metabolism
    STMDT12_C42090
   00052 Galactose metabolism
    STMDT12_C42090
  Energy metabolism
   00680 Methane metabolism
    STMDT12_C42090
Enzymes [BR:sem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     STMDT12_C42090
Protein phosphatases and associated proteins [BR:sem01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     STMDT12_C42090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
4377419..4378381
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVVPEVEFNREDLVAEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLEGHGGRCVGIQNEQLVHHDIIDA
IENMKRPFKSDWMECAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccgggcatgaacgcggca
atccgcggtgttgtgcgcgcagcgttgacggaagggctggaagtcatgggcatttatgac
ggctatctgggcctgtatgaagatcgtatggttcagcttgaccgttacagcgtatctgac
atgatcaaccgtggcggtactttcctcggttctgcccgtttcccggaattccgtgacgaa
aatattcgcgctgtcgcgatcgaaaacctgaaaaaacgcggtatcgatgcgctggtagtt
attggcggcgacggttcttatatgggtgcaaaacgtctgactgaaatgggcttcccgtgc
atcggtctgccaggcactatcgataacgacatcaaaggcaccgactacactatcggctac
ttcactgctctcggcactgtagtggaagcgattgaccgtctgcgtgacacctcctcttct
caccagcgtatctctatcgttgaggtgatgggccgttattgcggcgacctgacgttggcg
gcggctattgctggcggctgtgagtttatcgtggtgccggaagttgaatttaatcgcgag
gatctggtggcggaaatcaaagccgggatcgcgaaagggaaaaaacacgctatcgtcgct
atcaccgaacatatgtgtgatgttgacgagctggcgcactttattgaaaaagaaacgggc
cgtgaaacgcgtgcgacggtgctcggccacattcagcgcggtggttccccggtaccttac
gatcgcattctggcttcccgtatgggcgcgtatgctattgacctgctgctggaaggccat
ggcggtcgttgtgtcggtatccagaacgagcagcttgttcatcatgacatcatcgatgcg
attgaaaacatgaagcgtccgttcaaaagcgactggatggagtgcgcgaaaaaactgtac
tga

DBGET integrated database retrieval system