KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C46820Help
Entry
STMDT12_C46820    CDS       T01742                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    STMDT12_C46820
   00240 Pyrimidine metabolism
    STMDT12_C46820
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    STMDT12_C46820
   03430 Mismatch repair
    STMDT12_C46820
   03440 Homologous recombination
    STMDT12_C46820
Enzymes [BR:sem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     STMDT12_C46820
DNA replication proteins [BR:sem03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     STMDT12_C46820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
4909651..4910088
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRA
LTVSPDQVLPLTPERVAMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAA
LWQQICEHEHDFYPQHDRSPRSLAD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggtattacgcagtgggcgctgcga
cgtcctggcgcgctacagggcgagattgcgatttcccttcccgcgcacgttcgtctgatc
gtggttgcagaggaattacctgcgctgaacgagccgctaatgcgcgatatcttacgcgcg
ttgaccgtgagtcccgatcaggttttaccgctgacgcctgagcgcgtcgccatgctgccg
cagggcagccgttgtaatagctggcggttaggaactgacgcgccgctccaactcgaaggc
gctcaggtcacgacgccggcgtttaatgaactccgggcaaacccggcggcacgcgccgca
ctatggcaacaaatctgcgaacatgaacacgatttctatcctcagcacgaccgatctccc
cgcagcctggcagattga

DBGET integrated database retrieval system